DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP96A15

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_176086.1 Gene:CYP96A15 / 842150 AraportID:AT1G57750 Length:497 Species:Arabidopsis thaliana


Alignment Length:511 Identity:117/511 - (22%)
Similarity:195/511 - (38%) Gaps:129/511 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GVPFVPAAPFVGNVWNLLRGACCFGDQFRELY----ESKEAAGRAFV-------GIDVLHNHALL 103
            |.|.:...||:..:..:|.       |...:|    |..||....|.       |.|:     |.
plant    29 GQPILKNWPFLRMLPGMLH-------QIPRIYDWTVEVLEATNLTFYFKGPWLSGTDM-----LF 81

  Fly   104 LRDPALIKRIMVEDFA------QFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFF--- 159
            ..||..|..|:..:|.      :|...|       |.:| :.:....:|.|.|..|.....|   
plant    82 TADPRNIHHILSSNFGNYPKGPEFKKIF-------DVLG-EGILTVDFELWEEMRKSNHALFHNQ 138

  Fly   160 -------AAGKVRNMYGL---LENIGQK-----LEEHMEQ--------KLSGRDSMELEVKQLCA 201
                   ::.|.:...||   |:|..||     |::..::        .::|.|.|.|.::.|  
plant   139 DFIELSVSSNKSKLKEGLVPFLDNAAQKNIIIELQDVFQRFMFDTSSILMTGYDPMSLSIEML-- 201

  Fly   202 LFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYSEE 266
                    .:.|| ||..:......:|.                |......||.:.:|..|    
plant   202 --------EVEFG-EAADIGEEAIYYRH----------------FKPVILWRLQNWIGIGL---- 237

  Fly   267 YERFMRKSMDYV-------LSQRAESGENR-------HDLIDIFLQLKRTEPAESIIHRPDFFAA 317
             ||.||.::..|       :|.|.:...:|       .|.:..::.:. |...:.:....|.|..
plant   238 -ERKMRTALATVNRMFAKIISSRRKEEISRAKTEPYSKDALTYYMNVD-TSKYKLLKPNKDKFIR 300

  Fly   318 QAAF-LLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQV 381
            ...| |:|||.||:||.:|:..:.|:|:..:..:||.|:.....:        :.:..||||...
plant   301 DVIFSLVLAGRDTTSSVLTWFFWLLSKHPQVMAKLRHEINTKFDN--------EDLEKLVYLHAA 357

  Fly   382 VDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEV-FD 445
            :.|.:|||||..|..:   |....|:.|    |..|:.|.:.:.|.:..:.|....|....: |.
plant   358 LSESMRLYPPLPFNHK---SPAKPDVLP----SGHKVDANSKIVICIYALGRMRSVWGEDALDFK 415

  Fly   446 PERFSAEQRQQHHPMTY--LPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCE 499
            |||:.::.....|..:|  :.|.:|||.|:|..|..|::|:..|.|:.::..:|.|
plant   416 PERWISDNGGLRHEPSYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNYDFKVIE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 107/466 (23%)
CYP96A15NP_176086.1 PLN02169 1..497 CDD:177826 117/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.