DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:443 Identity:103/443 - (23%)
Similarity:180/443 - (40%) Gaps:89/443 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRN 166
            |::.||::.|.|:.::...:|...  .....|.:..:.|..:..|.||...:...|......|..
plant   153 LIVSDPSIAKHILKDNAKAYSKGI--LAEILDFVMGKGLIPADGEIWRRRRRAIVPALHQKYVAA 215

  Fly   167 MYGLLENIGQKLEEHME-QKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNP------- 223
            |..|......:|.:.:: ..|.|.   |:|::.|.:..|.|||....|..:..||.|.       
plant   216 MISLFGEASDRLCQKLDAAALKGE---EVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAV 277

  Fly   224 -----EAEFRRMC-IEVND--------PRPKRL---LHLFTMFFFPRLSHRVGT--HLYSEE--- 266
                 |||.|.:. |.|.|        ||.:::   |.|..    ..|...:.|  .:..||   
plant   278 YTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKLIN----DTLDDLIATCKRMVEEEELQ 338

  Fly   267 -YERFMRKSMDYVLSQRAESGEN------RHDLIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLL 324
             :|.:|.:....:|.....||::      |.||:.                           :|:
plant   339 FHEEYMNERDPSILHFLLASGDDVSSKQLRDDLMT---------------------------MLI 376

  Fly   325 AGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLY 389
            ||.:||::.:|:..|.|....::..:|:.|:.:.:   .||..:...:..|.|..:|::|.||||
plant   377 AGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVI---GDRFPTIQDMKKLKYTTRVMNESLRLY 438

  Fly   390 P-PTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAE- 452
            | |...:.|..::    |:.     ..:.::.|..::|||..:||...:|.:.|.|:|||:..: 
plant   439 PQPPVLIRRSIDN----DIL-----GEYPIKRGEDIFISVWNLHRSPLHWDDAEKFNPERWPLDG 494

  Fly   453 --QRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLP 503
              ..:.:...:|||||.|||.|||.:....|..|.:..::..|..::.....|
plant   495 PNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPP 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 103/443 (23%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 103/443 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.