DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:296 Identity:59/296 - (19%)
Similarity:115/296 - (38%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVVTIVWLWQILHFWHW---RRLGVPFVPAAPFVGNVWNLLRGACCFGDQFRELYESKEAAGRAF 91
            |::.:.|:|:.:: |.|   :|| ..::....|.||.:.:|.|      ..||..:..:.|....
plant    16 LILILNWVWRAVN-WVWLRPKRL-EKYLKKQGFSGNSYRILMG------DMRESNQMDQVAHSLP 72

  Fly    92 VGIDV---------LHNHAL----------------LLRDPALIKRIMVEDFAQFSSRFETTDPT 131
            :.:|.         ||:..|                ::.||..::.||        |:.|.... 
plant    73 LPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIM--------SKHELFPK- 128

  Fly   132 CDTMGSQN-LFFS---KYE--TWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRD 190
             ..:||.| :|.|   .:|  .|.:...|..|.|....::::.....:..:::.|..|:..|.:.
plant   129 -PKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKG 192

  Fly   191 SMELEVKQLCALFTTDIIASLAF------GIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMF 249
            :|||:....|...|.:::|..:|      ||:...:|..:.:...:.|        |.:::....
plant   193 TMELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAI--------RAVYIPGSK 249

  Fly   250 FFP-RLSHRVGTHLYSEEYERFMRKSMDYVLSQRAE 284
            |.| :.:.|:      .|.||.||.....::..:.|
plant   250 FLPTKFNRRL------RETERDMRAMFKAMIETKEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 44/232 (19%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.