DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP96A4

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:472 Identity:114/472 - (24%)
Similarity:189/472 - (40%) Gaps:86/472 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DQFRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFA------QFSSRFE------- 126
            |...|..|::...| .|:|..:.....||..||..|:.|:..:|.      :|:..||       
plant    55 DFVTEALEAENMTG-CFIGPWLSGTDILLTVDPVNIQYILSSNFVNYPKGKKFNKIFEFLGDGIF 118

  Fly   127 TTDPTC--DTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNM-YGLLENIGQKLEEHMEQKLSG 188
            ..|...  |...|.:..||        |:.|..|..:..|..: .||:..:...:|:|       
plant   119 NVDSGLWEDMRNSSHAIFS--------HQDFQSFSVSTSVSKLSQGLVPILDNAVEKH------- 168

  Fly   189 RDSMELEVKQLCALFTTDIIASLAFGIEAHSL--QNPEAEFRRMCIEVNDPRPKRLLHLFTMFFF 251
               :.::::.|...|..|..::|..|.:..||  :.|:.||......|.|....|  ||...|.:
plant   169 ---ILVDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEFADAMDGVADAMFYR--HLKPAFLW 228

  Fly   252 PRLSHRVGTHLYSEEYERFMRKSMDY-------VLSQRAESGENR--HD----LIDIF------- 296
             .:...:|..:     |:.||:.:|.       ::|.:.|..:|.  ||    .:|:.       
plant   229 -SIQSWIGVGI-----EKKMRRGLDVFDQMLGKIISAKREEIKNHGIHDSKGEAMDVLTYYMTID 287

  Fly   297 -LQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQ 360
             .:.|..:|:.....|.....     |::|..||:||.:|:..:.|:||.....::|.|:...:.
plant   288 TTKYKHLKPSNDKFIRDTILG-----LVIAARDTTSSALTWFFWLLSKNPEAMTKIRQEINKKMP 347

  Fly   361 SSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVY 425
            ......|.     .||||...|.|.|||||...|..:   |....|:.|    |..|:.....|.
plant   348 KFDPADLD-----KLVYLDGAVCETLRLYPSVPFNHK---SPAKPDVLP----SGHKVDKNWRVV 400

  Fly   426 ISVLGIHRDAQYW-PNPEVFDPERFSAE--QRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLL 487
            |.:..:.|....| .:.|.|.|||:.::  ..:|.....:|.|.||||.|:|..|..|::|...:
plant   401 IPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGKRLTFLQMKTVAV 465

  Fly   488 HILNHFRVEVCERTLPE 504
            .|:.::.::|.|...|:
plant   466 EIIRNYDIKVVEGHKPK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 110/456 (24%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 114/472 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.