DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP709B1

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_566092.1 Gene:CYP709B1 / 819310 AraportID:AT2G46960 Length:519 Species:Arabidopsis thaliana


Alignment Length:425 Identity:110/425 - (25%)
Similarity:188/425 - (44%) Gaps:65/425 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRN 166
            :.:.||.|.| .|:.:...|..:.:........:||:.|.|.:...|....:|..|.|:..:::.
plant   106 ICISDPELAK-TMLSNKLGFFVKSKARPEAVKLVGSKGLVFIEGADWVRHRRILNPAFSIDRLKI 169

  Fly   167 MYGLLENIGQKLEEHMEQKLSGRDS----MELEVKQLCALFTTDIIASLAFG---IEAHSLQNPE 224
            |..::.:...|:.|...::.:..::    ::.|:.:.....|.||||:.|||   :|...:...:
plant   170 MTTVMVDCTLKMLEEWRKESTKEETEHPKIKKEMNEEFQRLTADIIATSAFGSSYVEGIEVFRSQ 234

  Fly   225 AEFRRMCI-----EVNDPRPKRLLHLFTMFFFPRLSH-RVGTHLYSEEYERFMRKSMDYVLSQRA 283
            .|.:| |.     :|:.|..:         :.|..|: ||.      :.||.|..|:..::|.|.
plant   235 MELKR-CYTTSLNQVSIPGTQ---------YLPTPSNIRVW------KLERKMDNSIKRIISSRL 283

  Fly   284 ES-GENRHDLIDIFLQLKRTE------PAESIIH--RPDFFAAQAAFLLLAGFDTSSSTITFALY 339
            :| .:...||:.|.|:...||      ..|.|||  |..||         .|.:|:|:.:.:...
plant   284 QSKSDYGDDLLGILLKAYNTEGKERKMSIEEIIHECRTFFF---------GGHETTSNLLAWTTM 339

  Fly   340 ELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDR--CCNSR 402
            .|:.:...|::||.|:  ..:..:::....:|.:.|..:..|:.|.||||.|.:.|.|  ..|.:
plant   340 LLSLHQDWQEKLREEI--FKECGKEKTPDSETFSKLKLMNMVIMESLRLYGPVSALAREASVNIK 402

  Fly   403 TGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYW-PNPEVFDPERF-SAEQRQQHHPMTYLPF 465
            .| ||         ::..||.|.|.:|.:|.|...| .:.:.|:|.|| :...|..:||...|.|
plant   403 LG-DL---------EIPKGTTVVIPLLKMHSDKTLWGSDADKFNPMRFANGVSRAANHPNALLAF 457

  Fly   466 GAGPRGCIGTLLGQLEIKVGLLHILNHFR-VEVCE 499
            ..|||.|||.....:|.|..|..||..|| :.:|:
plant   458 SVGPRACIGQNFVMIEAKTVLTMILQRFRFISLCD 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 110/425 (26%)
CYP709B1NP_566092.1 p450 32..517 CDD:299894 110/425 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.