DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:496 Identity:124/496 - (25%)
Similarity:215/496 - (43%) Gaps:87/496 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FVGNVWNLLRGACCFGDQFRELYESKEAAGRAFVG-----IDVLHNHALLLRDPALIKRIMVED- 117
            ::.::....|.|||:                 :||     |.:.|        ||.||.:::.. 
Mouse    76 YIQSLVRTFRDACCW-----------------WVGPLHPVIRIFH--------PAFIKPVVLAPA 115

  Fly   118 --------FAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENI 174
                    |.:|...:         :| ..|..|..:.|....::..|.|.. .:...|..:.|.
Mouse   116 LVAPKDTVFYRFLKPW---------LG-DGLLMSTGDKWSRHRRMLTPAFHF-NILKPYVKVFND 169

  Fly   175 GQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVND--- 236
            ...:.....|:|:.:.|..|.:.:..:|.|.|.:....|..:::..:.| :|:....:|::.   
Mouse   170 STNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKP-SEYITAILELSTLVA 233

  Fly   237 PRPKRLLHLFTMFFFPRLSH-----RVGTHLYSEEYERFMRKSMDYVLSQ------RAESGENRH 290
            .|.:|||....:|::  |:|     |....|..:..:..:|:....:|.|      :|::.....
Mouse   234 RRHQRLLLHVDLFYY--LTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTL 296

  Fly   291 DLIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTEL 355
            |.||:.| |.:.|..:::  ..:...|:|...:..|.||::|.:::.||.||::...|:|.|.|:
Mouse   297 DFIDVLL-LSKDEHGKAL--SDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEV 358

  Fly   356 RAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRA 420
            |..|:..:..::..|.:..|.:|...:.|.|||:||...:.|||..    |:...:|.   .:..
Mouse   359 RELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQ----DIVLPDGR---VIPK 416

  Fly   421 GTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVG 485
            |....||:.|.|.:...||:|||:||.||.|:..:...|:.::||.||||.|||......|:||.
Mouse   417 GVISRISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVA 481

  Fly   486 LLHILNHFRVEVCERTLP---EMRFDPKAFVLTAHNGTYLR 523
            |...|..|||      ||   |.|..|: .:|.|..|.:|:
Mouse   482 LALTLLRFRV------LPDDKEPRRKPE-LILRAEGGLWLK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 116/454 (26%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 124/496 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.