DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP4F12

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:562 Identity:134/562 - (23%)
Similarity:227/562 - (40%) Gaps:121/562 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLLPVVLRGGCLLVVTIVWLWQILH--------------FWHWRRLG----------------- 50
            |:||.||  |..||...:.|.:...:              .|.|..||                 
Human    20 LLLLLVV--GSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEEGLKNSTQMSA 82

  Fly    51 -------VPFVPAAPFVGNVWNLLRGACCFGDQFRELYESKEAAGRAFVGIDVLHNHALLLRDPA 108
                   |...|..||:         ..|..|..|.:..:..|                      
Human    83 TYSQGFTVWLGPIIPFI---------VLCHPDTIRSITNASAA---------------------- 116

  Fly   109 LIKRIMVED--FAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLL 171
                |..:|  |.:|...:         :| :.:..|..:.|....::..|.|....::: |..:
Human   117 ----IAPKDNLFIRFLKPW---------LG-EGILLSGGDKWSRHRRMLTPAFHFNILKS-YITI 166

  Fly   172 ENIGQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVND 236
            .|....:.....|.|:...|..|::.:..:|.|.|.:....|..::|..:.| :|:....:|::.
Human   167 FNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERP-SEYIATILELSA 230

  Fly   237 PRPKRLLHLFT-MFFFPRLSH---------RVGTHLYSEEYERFMRKSM-----DYVLSQRAESG 286
            ...||..|:.. |.|...|||         |: .|.:::...|..|:::     |.....:|:| 
Human   231 LVEKRSQHILQHMDFLYYLSHDGRRFHRACRL-VHDFTDAVIRERRRTLPTQGIDDFFKDKAKS- 293

  Fly   287 ENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRL 351
             ...|.||:.| |.:.|..:::  ..:...|:|...:..|.||::|.:::.||.||::...|:|.
Human   294 -KTLDFIDVLL-LSKDEDGKAL--SDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERC 354

  Fly   352 RTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPF 416
            |.|::..|:....:::..|.:..|.:|...|.|.|||:||..|:.|||..    |:...:|.   
Human   355 RQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQ----DIVLPDGR--- 412

  Fly   417 KLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLE 481
            .:..|....|.::|:|.:...||:|||:||.||..|..:...|:.::||.||||.|||......|
Human   413 VIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAE 477

  Fly   482 IKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLR 523
            :||.|..:|.|||. :.:.|.|..:.:   .::.|..|.:||
Human   478 MKVVLALMLLHFRF-LPDHTEPRRKLE---LIMRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 109/440 (25%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 121/517 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.