DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and cyp4f2

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:404 Identity:104/404 - (25%)
Similarity:179/404 - (44%) Gaps:44/404 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFT 204
            |..|:.|.|.:..::..|.|....::| |..:.|....:.....::|:....:.|::.:..:|.|
 Frog   143 LLLSRGEKWGQHRRLLTPAFHFDILKN-YVKIFNQSTDIMLAKWRRLTAEGPVSLDMFEHVSLMT 206

  Fly   205 TDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKR---LLHLFTMFFFPRLS----------- 255
            .|.:....|..::...:.| :::.....|::....||   |.|.|.  |...||           
 Frog   207 LDTLLKCTFSYDSDCQEKP-SDYISAIYELSSLVVKREHYLPHHFD--FIYNLSSNGRKFRQACK 268

  Fly   256 --HRVGTHLYSEEYERFMRKSMDYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQ 318
              |.....:..:..:....|.|:..:  :::.|:.: |.|||.| |.:.|....:  ..:...|:
 Frog   269 TVHEFTAGVVQQRKKALQEKGMEEWI--KSKQGKTK-DFIDILL-LSKNEDGSQL--SDEDMRAE 327

  Fly   319 AAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVD 383
            ....:..|.||::|.:::.||.||.:...|::.|.|:...|:....:.|..|.::.|.:....:.
 Frog   328 VDTFMFEGHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIK 392

  Fly   384 EVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPER 448
            |.|||:||...:.|.|..    |:....|..   |..|....|::.|||.:...||||:|:||.|
 Frog   393 ESLRLHPPVVAVIRRCTE----DIKLPKGDI---LPKGNCCIINIFGIHHNPDVWPNPQVYDPYR 450

  Fly   449 FSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCE----RTLPEMRFDP 509
            |..|..|:.....::||.||||.|||......|:|:.|..||.:|:|.:.|    |..||:    
 Frog   451 FDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDETKTVRRKPEL---- 511

  Fly   510 KAFVLTAHNGTYLR 523
               :|.|.||.:|:
 Frog   512 ---ILRAENGLWLQ 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 99/394 (25%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 99/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.