DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4f40

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038935701.1 Gene:Cyp4f40 / 503122 RGDID:1559596 Length:530 Species:Rattus norvegicus


Alignment Length:410 Identity:111/410 - (27%)
Similarity:183/410 - (44%) Gaps:49/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFT 204
            |..|..:.|.....:..|.|.. .:...|..:.|....:......:|:...|..|::.:..:|.|
  Rat   136 LLVSASDKWSRHRSMLTPAFHF-NILKPYVKIFNDSTNIMHAKWLRLASGGSAHLDMFENISLMT 199

  Fly   205 TDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKR----LLHLFTMF-------FFPRLSHRV 258
            .|.:....|...::..:.| :|:....:|::....||    |||:..::       .|.:..|.|
  Rat   200 LDTLQKCVFSFNSNCQEKP-SEYIAAILELSALVVKRNEQLLLHMDLLYRLTPDGRRFYKACHLV 263

  Fly   259 GTHLYSEEYERFMRKSM-----DYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQ 318
            ....|:...||  |:::     |.|:..:|:|  ...|.||:.| |.:.|..:.:  ..:...|:
  Rat   264 HDFTYAVIQER--RRTLPKHGGDDVIKAKAKS--KTLDFIDVLL-LSKDEDGKEL--SDEDIRAE 321

  Fly   319 AAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSC-------DTVTGLV 376
            |...:..|.||::|.:::.||.|||:...|:|.|.|::..|:.....::.|       |.:..|.
  Rat   322 ADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQELLRDRDSEEIECSCGVLLRDDLAQLP 386

  Fly   377 YLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNP 441
            :|...:.|.|||:||...:.|||..    |:|..:|.   .:..|....|::...|.:...|.:|
  Rat   387 FLTMCIKESLRLHPPVTMVSRCCTQ----DISLPDGR---VIPKGIICIINIFATHHNPTVWQDP 444

  Fly   442 EVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLP--- 503
            ||:||.||..|..|...|:.::||.||||.|||......|:||.:...|..|||      ||   
  Rat   445 EVYDPFRFDPENIQARSPLAFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRV------LPDDK 503

  Fly   504 EMRFDPKAFVLTAHNGTYLR 523
            |.|..|: .:|.|.:|.:||
  Rat   504 EPRRKPE-LILRAEDGLWLR 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 106/400 (27%)
Cyp4f40XP_038935701.1 CYP4F 74..522 CDD:410772 109/408 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.