DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:456 Identity:101/456 - (22%)
Similarity:183/456 - (40%) Gaps:89/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLS 187
            |:.:..|.|...:| ..|..|....|.:..|:..|.|....:::.:.::.....|..:.:::...
  Fly   100 SKSDVYDLTHPWLG-LGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVAD 163

  Fly   188 GRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAE----FRRMCIEVN----DP--RPKRL 242
            |.:..:.:  :.....|.|:|...|.|:..::::|..:.    |:.:...:.    .|  |.|.|
  Fly   164 GGNIFDFQ--EEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYL 226

  Fly   243 LHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDY---VLSQRAE---SGENRHDLIDIFLQLKR 301
            .|     |.|..          .||.:.::...|:   ::::|.|   ||.......|.|.:.|.
  Fly   227 FH-----FAPEY----------PEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKM 276

  Fly   302 ----TEPAESIIHRP----DFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAA 358
                |..:..:..||    :.:...:.| :..|.||::|.:.||:|.|:::...|::|..|....
  Fly   277 AFLDTLLSSKVDGRPLTSQELYEEVSTF-MFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDV 340

  Fly   359 L-QSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGY----DLSPWNGGSPFKL 418
            : .|...|..:...::.:.:|...:.|..||||...|:.|.  :...|    |:.|         
  Fly   341 MGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRF--TEKDYVIDGDIVP--------- 394

  Fly   419 RAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIK 483
             .||.:.:.:|.:..:.:.:.:|..|.||||   .|::..|..|:||.||||.|||.....||||
  Fly   395 -KGTTLNLGLLMLGYNDRVFKDPHKFQPERF---DREKPGPFEYVPFSAGPRNCIGQKFALLEIK 455

  Fly   484 VGLLHILNHFRV-----------------------EVCERTLPEMRFDP---KAFVLTAHNGTYL 522
            ..:..|:.:|.|                       |...|.....::||   .:..|.:.||.:|
  Fly   456 TVVSKIIRNFEVLPALDELVSKDGYISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHL 520

  Fly   523 R 523
            |
  Fly   521 R 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 96/446 (22%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 92/402 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.