DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:560 Identity:146/560 - (26%)
Similarity:229/560 - (40%) Gaps:96/560 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVGSLVLLPVVLRGG-CLLVVTIVWL------WQILHFWHWRRLGVPFVPAAP----FVGNVWN 65
            |::.||.|.|:..... .||:|...||      |....:.:..||..  .|..|    |:|:: .
Human     4 LSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRC--FPQPPKRNWFLGHL-G 65

  Fly    66 LLRG-----------ACCFGDQFRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRIMV---- 115
            |:..           ||.|||..........|..|.|              .|..||.::.    
Human    66 LIHSSEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIF--------------HPTYIKPVLFAPAA 116

  Fly   116 -----EDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIG 175
                 :.|..|...:         :| ..|..|..|.|....::..|.|.. .:...|..:.|..
Human   117 IVPKDKVFYSFLKPW---------LG-DGLLLSAGEKWSRHRRMLTPAFHF-NILKPYMKIFNES 170

  Fly   176 QKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPK 240
            ..:.....|.|:...|..|::.:..:|.|.|.:....|..::|..:.| :|:....:|::....|
Human   171 VNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTK 234

  Fly   241 R----LLHL-FTMFFFP---------RLSHRVGTHLYSEEYERFMRKSMDYVLSQRAESGENRHD 291
            |    ||:: |..:..|         ||.|.....:..|.......:.:|..|..:|:|  ...|
Human   235 RHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKS--KTLD 297

  Fly   292 LIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELR 356
            .||:.| |.:.|..:.:  ..:...|:|...:..|.||::|.:::.||.|||:...|:|.|.|::
Human   298 FIDVLL-LSKDEDGKKL--SDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQ 359

  Fly   357 AALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAG 421
            ..|:..:.:::..|.:..|.:|...:.|.|||:||...:.|||..    |:...:|.   .:..|
Human   360 ELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQ----DIVLPDGR---VIPKG 417

  Fly   422 TPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGL 486
            ....|||.|.|.:...||:|||:||.||..:..::..|:.::||.||||.|||......|:||.|
Human   418 IICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482

  Fly   487 LHILNHFRVEVCERTLP---EMRFDPKAFVLTAHNGTYLR 523
            ...|..|||      ||   |.|..|: .||.|..|.:||
Human   483 GLTLLRFRV------LPDHTEPRRKPE-LVLRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 116/449 (26%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 131/508 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.