DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4e3

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster


Alignment Length:473 Identity:105/473 - (22%)
Similarity:206/473 - (43%) Gaps:84/473 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLLRDPALIKRIM-VEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVR 165
            :::.:|..::.|: .:...|.|:.::...|... .|....|.||   |.:..|:..|.|....::
  Fly    81 IVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLG-HGLLTSFGSK---WHKHRKMITPSFHFNILQ 141

  Fly   166 NMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAE---- 226
            :.:.::.....|....: :|.|..|:: ::.::.....|.|:|...|.|:..::::..::.    
  Fly   142 DFHEVMNENSAKFMTQL-KKASAGDTI-IDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQA 204

  Fly   227 FRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYS-----EEYERFMRKSMDY---VLSQRA 283
            ||.||..:|    .|..|.|      :.|:||    :|     ..|::.::...|:   ::.:|.
  Fly   205 FRDMCYNIN----MRAFHPF------KRSNRV----FSLTPEFSAYQKTLKTLQDFTYDIIEKRV 255

  Fly   284 ---ESGENRHDLIDIFLQLKRTEPAESIIH---------RPDFFAAQAAFLLLAGFDTSSSTITF 336
               ::|.::.| .|..|..|:....::::.         |.:.:...:.| :..|.||::|.::|
  Fly   256 YALQNGGSKED-HDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTF-MFEGHDTTTSGVSF 318

  Fly   337 ALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNS 401
            ::|.|:::..:|.:|..|....:....:|.:|...:..:.||...:.|..|:||...|:.|.|:.
  Fly   319 SVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDK 383

  Fly   402 RTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFG 466
              .||:   ||....|   ||.:.::::.:..:.:.:.:|..|.||||..|:..   |..||||.
  Fly   384 --DYDI---NGSIVPK---GTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPA---PFEYLPFS 437

  Fly   467 AGPRGCIGTLLGQLEIKVGLLHILNHFRV-----------------------EVCERTLPEMRFD 508
            ||||.|||.....||:|..:..::..|.|                       |..:|.....::|
  Fly   438 AGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGRHKYD 502

  Fly   509 P---KAFVLTAHNGTYLR 523
            |   ....|.:.||.:||
  Fly   503 PILSAVLTLKSDNGLHLR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 100/463 (22%)
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 96/419 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.