DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4ac1

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_608916.1 Gene:Cyp4ac1 / 33754 FlyBaseID:FBgn0031693 Length:509 Species:Drosophila melanogaster


Alignment Length:403 Identity:104/403 - (25%)
Similarity:174/403 - (43%) Gaps:49/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFT 204
            |..|....|....|...|.|....:::..|:.:...:|....:|:.|..    |||:.|:...||
  Fly   131 LLISTDHKWHSRRKALTPAFHFNVLQSFLGIFKEECKKFLNVLEKNLDA----ELELNQVIPPFT 191

  Fly   205 TDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRL---LHLFTMFFFP-----------RLS 255
            .:.|...|.|::...:.... |:|:....:.:...:|:   |..:..:||.           |:.
  Fly   192 LNNICETALGVKLDDMSEGN-EYRKAIHAIEEVLIQRVCNPLMYYNWYFFVYGDYRKHLQNLRIV 255

  Fly   256 HRVGTHLYSEEYERFMRKSMDYVLSQRAESG-ENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQA 319
            |...:.:...:.::|.:|.    |.:..|.| :.|:.::|..|   ..|....|.|:.  ...:.
  Fly   256 HDFSSRIIERKRQQFQQKQ----LGEVDEFGRKQRYAMLDTLL---AAEADGQIDHQG--ICDEV 311

  Fly   320 AFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDE 384
            ...:..|:||:|:.:.|.|..||.:..:|.:...|:....:.|.|  :|......||||..|:.|
  Fly   312 NTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVENLPEDSDD--ISMFQFNKLVYLECVIKE 374

  Fly   385 VLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERF 449
            .||::|...|:.|.|...|..     ||   ..:...|.:.|.:..|.||.:::|.|::|.|:||
  Fly   375 SLRMFPSVPFIGRQCVEETVV-----NG---MVMPKDTQISIHIYDIMRDPRHFPKPDLFQPDRF 431

  Fly   450 SAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVL 514
            ..|.....||..|:||.||.|.|||.....||:||.|..::.:|::      ||..:.:.    |
  Fly   432 LPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKL------LPATQLED----L 486

  Fly   515 TAHNGTYLRFVKN 527
            |..||..||..:|
  Fly   487 TFENGIVLRTQEN 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 97/389 (25%)
Cyp4ac1NP_608916.1 p450 86..504 CDD:278495 104/403 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.