DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:462 Identity:117/462 - (25%)
Similarity:189/462 - (40%) Gaps:83/462 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRN 166
            :||.||..:|.::.....:.|..::...|...:.....|.....:.|.:..::..|.|       
  Rat    94 VLLYDPDYVKVVLGRSDPKASGIYQFLAPWIVSGTGYGLLLLNGKKWFQHWRMLTPAF------- 151

  Fly   167 MYGLLENIGQKLEEHME------QKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEA 225
            .||:|:...:.:.:.:.      :||..:|. .||:....:|.|.|.:...||..:. |:|    
  Rat   152 HYGILKPYVKIMADSVSIMLDKWEKLDDQDH-PLEIFHYVSLMTLDTVMKCAFSHQG-SVQ---- 210

  Fly   226 EFRRMCIEVND-PRPKRLLHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDYVLSQRA------ 283
                  ::||. ...|.:..|..:.||     ||.:..|....  ....|.|..||:||      
  Rat   211 ------LDVNSRSYTKAVEDLNNLTFF-----RVRSAFYGNSI--IYNMSSDGRLSRRACQIAHE 262

  Fly   284 --------------------ESGENRH-DLIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGF 327
                                ::.:.|| |.:||.| ..:.|..:|:  ..:...|:....:..|.
  Rat   263 HTDGVIKMRKAQLQNEEELQKARKKRHLDFLDILL-FAKMEDGKSL--SDEDLRAEVDTFMFEGH 324

  Fly   328 DTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPT 392
            ||::|.|::..|.||.:...|:|.|.|:::.|  .....::.|.:..:.|....:.|.||||||.
  Rat   325 DTTASGISWVFYALATHPEHQERCREEVQSIL--GDGTSVTWDHLDQISYTTMCIKEALRLYPPV 387

  Fly   393 AFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQH 457
            ..:.|..:|...:.    :|.|   :..|....|.:.|:|.:..|||||:||||.|||.:..:..
  Rat   388 PSVSRELSSPVTFP----DGRS---IPKGITTTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHS 445

  Fly   458 HPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDP---KAFVLTAHNG 519
            |  .||||..|.|.|||......|:||.:...|..|.:      ||:....|   ...||.:.||
  Rat   446 H--AYLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL------LPDPTRIPVPMARLVLKSKNG 502

  Fly   520 TYLRFVK 526
            .:||..|
  Rat   503 IHLRLKK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 111/449 (25%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 114/457 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.