DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4f4

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_775146.1 Gene:Cyp4f4 / 286904 RGDID:708363 Length:522 Species:Rattus norvegicus


Alignment Length:405 Identity:108/405 - (26%)
Similarity:184/405 - (45%) Gaps:46/405 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFT 204
            |..|..:.|....::..|.|.. .:...|..:.|....:.....|.|:...|..|::.:..:|.|
  Rat   136 LLLSDGDKWSCHRRMLTPAFHF-NILKPYVKIFNDSTNIMHAKWQDLASGGSARLDMFKNISLMT 199

  Fly   205 TDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKR----LLHLFTMFFFPRLSHRVG------ 259
            .|.:....|..:::..:.| :|:....:|::....||    |||..:::   :|:|. |      
  Rat   200 LDSLQKCVFSFDSNCQEKP-SEYISAILELSALVAKRYQQLLLHTDSLY---QLTHN-GRRFHKA 259

  Fly   260 ---THLYSEEYERFMRKSM-----DYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDFFA 316
               .|.:::...:..|:::     |.:|..:|.|  ...|.||:.| |.:.|..:.:  ..:...
  Rat   260 CKLVHNFTDAVIQGRRRALPSQHEDDILKAKARS--KTLDFIDVLL-LTKDEDGKEL--SDEDIR 319

  Fly   317 AQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQV 381
            |:|...:..|.||::|.:::.||.||::...|:|.|.|:|..|:..:..::..|.:..|.:|...
  Rat   320 AEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDRESTEIEWDDLAQLPFLTMC 384

  Fly   382 VDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDP 446
            :.|.|||:||...:.|.|..    |:...:|.   .:..|....|::...|.:...||:|||:||
  Rat   385 IKESLRLHPPVTVISRRCTQ----DIVLPDGR---VIPKGVICIINIFATHHNPTVWPDPEVYDP 442

  Fly   447 ERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLP---EMRFD 508
            .||..|..:...|:.::||.||||.|||......|:||.|...|..|||      ||   |.|..
  Rat   443 FRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLRFRV------LPDDKEPRRK 501

  Fly   509 PKAFVLTAHNGTYLR 523
            |: .:|.|..|.:||
  Rat   502 PE-LILRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 103/395 (26%)
Cyp4f4NP_775146.1 CYP4F 74..515 CDD:410772 106/403 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.