DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4a12a

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_803125.2 Gene:Cyp4a12a / 277753 MGIID:88612 Length:508 Species:Mus musculus


Alignment Length:454 Identity:109/454 - (24%)
Similarity:181/454 - (39%) Gaps:79/454 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGL 170
            ||..:|.|:.....:.:..:....|..    .:.|.....:||.:..::..|.|       .|.:
Mouse    99 DPDYMKLILGRSDPKANGSYRFLAPWI----GRGLLMLDGQTWFQHRRMLTPAF-------HYDI 152

  Fly   171 LENIGQKLEEHME------QKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAH-SLQNPEAEFR 228
            |:...:.:.:.:.      :::.|:|| .||:.:...|.|.|.|...||..|.. .|......:.
Mouse   153 LKPYTEIMADSVRVMLDKWEQIVGQDS-TLEIFRHITLMTLDTIMKCAFSHEGSVQLDRKYKSYI 216

  Fly   229 RMCIEVND---PRPKRLLHLFTMFF-----------FPRLSHRVGTHLY---------SEEYERF 270
            :...::||   .|.:.:.|...:.:           ..:|:|.....:.         .||.|:.
Mouse   217 QAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANSACKLAHDHTDQVIKSRRIQLQDEEELEKL 281

  Fly   271 MRKSMDYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTIT 335
            .:|              .|.|.:||.| ..|.|..:|:..:.  ..|:....:..|.||::|.|:
Mouse   282 KKK--------------RRLDFLDILL-FARMENGKSLSDKD--LRAEVDTFMFEGHDTTASGIS 329

  Fly   336 FALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCN 400
            :..|.||.|...|.|.|.|:::.|  .....::.:.:..:.|....:.|.||:|||...:.|..:
Mouse   330 WIFYALATNPEHQQRCRKEIQSLL--GDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELS 392

  Fly   401 SRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPF 465
            |...:.    :|.|   |..|..|.:|..|:|.:...|||||||||.||:....:..|  ::|||
Mouse   393 SPVTFP----DGRS---LPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSH--SFLPF 448

  Fly   466 GAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDP---KAFVLTAHNGTYLRFVK 526
            ..|.|.|||......|:||.:...|..|.:      ||:....|   ...||.:.||.:|...|
Mouse   449 SGGARNCIGKQFAMNELKVAVALTLLRFEL------LPDPTRVPIPIPRIVLKSKNGIHLHLKK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 104/441 (24%)
Cyp4a12aNP_803125.2 p450 52..502 CDD:278495 107/448 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.