DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:403 Identity:110/403 - (27%)
Similarity:173/403 - (42%) Gaps:53/403 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 ETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIAS 210
            :||.:..::..|.|....::...|::.:..:.:.:..|| :.|:|| .||:.|...|.|.|.|..
  Rat   137 QTWFQHRRMLTPAFHYDTLKPYVGIMADSVRIMLDKWEQ-IVGQDS-TLEIFQHITLMTLDTIMK 199

  Fly   211 LAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYS----------- 264
            .||..|. |:| .:.:::.....|.|      |:..:.|....:.|: ...:||           
  Rat   200 CAFSQEG-SVQ-LDRKYKSYIKAVED------LNNLSFFRIRNIFHQ-NDIIYSLSSNGRKARSA 255

  Fly   265 ----EEYERFMRKSMDYVLSQRAE----SGENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQAAF 321
                .|:...:.||....|....|    ..:.|.|.:||.| ..|.|...|:..:.  ..|:...
  Rat   256 WQLAHEHTDQVIKSRKAQLQDEEELQKVKQKRRLDFLDILL-FARIENGSSLSDKD--LRAEVDT 317

  Fly   322 LLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVL 386
            .:..|.||::|.|::..|.||.|...|...|.|:::.|  .....::.|.:..:.|....:.|.|
  Rat   318 FMFEGHDTTASGISWIFYALATNPEHQQGCRKEIQSLL--GDGASITWDDLDKMPYTTMCIKEAL 380

  Fly   387 RLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSA 451
            |:|||...:.|..::...:.    :|.|   |..|..|.:|..|:|.:...|||||||||.||:.
  Rat   381 RIYPPVTAVSRMLSTPVTFP----DGRS---LPKGITVMLSFYGLHHNPTVWPNPEVFDPYRFAP 438

  Fly   452 EQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDP---KAFV 513
            |..:..|  ::|||..|.|.|||......|:||.:...|..|.:      ||:....|   ...|
  Rat   439 ESSRHSH--SFLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL------LPDPTRIPIPIPRLV 495

  Fly   514 LTAHNGTYLRFVK 526
            |.:.||.|||..|
  Rat   496 LKSKNGIYLRLKK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 103/390 (26%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 107/398 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.