DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4a2

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus


Alignment Length:498 Identity:119/498 - (23%)
Similarity:184/498 - (36%) Gaps:149/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRN 166
            :||.||..:|.::           ..:||                   :.::..||:..      
  Rat    94 VLLYDPDYVKVVL-----------GRSDP-------------------KPYQSLAPWIG------ 122

  Fly   167 MYGLLENIGQKLEEHME-----------------------------QKLSGRDSMELEVKQLCAL 202
             ||||...|:|..:|..                             :||..:|. .||:....:|
  Rat   123 -YGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKLDDQDH-PLEIFHYVSL 185

  Fly   203 FTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVND-PRPKRLLHLFTMFFFPRLSHRVGTHLYSEE 266
            .|.|.:...||..:. |:|          ::||. ...|.:..|..:.||     ||.:..|...
  Rat   186 MTLDTVMKCAFSHQG-SVQ----------LDVNSRSYTKAVEDLNNLIFF-----RVRSAFYGNS 234

  Fly   267 YERFMRKSMDYVLSQRA---------------------------------------ESGENRH-D 291
            .  ....|.|..||:||                                       ::.:.|| |
  Rat   235 I--IYNMSSDGRLSRRACQIAHEHTGSVFLLPAFLSLSDGVIKTRKAQLQNEEELQKARKKRHLD 297

  Fly   292 LIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELR 356
            .:||.| ..:.|..:|:  ..:...|:....:..|.||::|.|::..|.||.:...|:|.|.|::
  Rat   298 FLDILL-FAKMEDGKSL--SDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQ 359

  Fly   357 AALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAG 421
            :.|  .....::.|.:..:.|....:.|.||||.|...:.|..:|...:.    :|.|   :..|
  Rat   360 SIL--GDGTSVTWDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFP----DGRS---IPKG 415

  Fly   422 TPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGL 486
            ..|.|.:.|:|.:..|||||:||||.|||.:..:..|  .||||..|.|.|||......|:||.:
  Rat   416 IRVTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHSH--AYLPFSGGARNCIGKQFAMNELKVAV 478

  Fly   487 LHILNHFRVEVCERTLPEMRFDP---KAFVLTAHNGTYLRFVK 526
            ...|..|.:      ||:....|   ...||.:.||.:||..|
  Rat   479 ALTLLRFEL------LPDPTRIPVPMPRLVLKSKNGIHLRLKK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 113/485 (23%)
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 116/493 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.