DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:186 Identity:42/186 - (22%)
Similarity:81/186 - (43%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 HWRRLGVPFVPAAPFVGNVWNLLRGACCFG-----DQFRELYESKEAAGRAFVGIDVLHNHALLL 104
            ||            .:||:..::......|     |.:.:|::........:.|..:..|    :
 Worm    42 HW------------LMGNLKQIIERKAKLGYDDSYDWYNKLHKQFGETFGIYFGTQLNIN----I 90

  Fly   105 RDPALIKRIMVEDFAQFSSRFETTDPTC-DTMGSQNLFFSKYET-WRETHKIFAPFFAAGKVRNM 167
            .:...||.:.:::|:.||.|  |..|.. |....::|..:.||: |:.|....||.|:.||::.|
 Worm    91 TNEEDIKEVFIKNFSNFSDR--TPPPIIEDNKLKESLLQNTYESGWKHTRSAIAPIFSTGKMKAM 153

  Fly   168 YGLLENIGQKLE---EHMEQKLSGRDSMEL--EVKQLCALFTTDIIASLAFGIEAH 218
            :   |.|..|::   |.:::|.|.....::  :.:.|    |.|:|...||.|:::
 Worm   154 H---ETIHSKVDLFLEILKEKASSGQKWDIYDDFQGL----TLDVIGKCAFAIDSN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 35/135 (26%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 42/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.