DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and cest-32

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:119 Identity:28/119 - (23%)
Similarity:46/119 - (38%) Gaps:33/119 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 DSMELEVKQLCALFTT-------------------DIIASLAFGIE----AHSLQNPEAEFRRMC 231
            |.:..|..:|.|:.|.                   |||.| :||.:    |..:|....||....
 Worm   313 DELSREAPKLDAMATVDEYEGLGFLTMFQSRRNDMDIIKS-SFGSDVVENAVDVQKRIMEFYMKN 376

  Fly   232 IEVNDPR--PKRLLHLFTMFFF-------PRLSHRVGTHLYSEEYERFMRKSMD 276
            |:.||.:  .|||:.|.:..:|       .:.|.:.|::.|...::.:...|.|
 Worm   377 IDKNDDKAVEKRLIQLISDSWFNIGALETVKTSTKYGSNAYLGSFDYYNMGSND 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 28/119 (24%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 28/119 (24%)
Aes <104..>227 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.