DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:410 Identity:104/410 - (25%)
Similarity:163/410 - (39%) Gaps:78/410 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 WRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCAL--FTTDIIAS 210
            |.:..|:..|.|....::....:.....:.:.:..|:|.|...|.::    .|.:  ...|.:..
Mouse   134 WFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKASENKSFDI----FCDVGHMALDTLMK 194

  Fly   211 LAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYSEEY-------- 267
            ..||.....|.:.:..:   .:.|:|         .|:.    :..|:.:..|..::        
Mouse   195 CTFGKGDSGLSHSDNSY---YLAVSD---------LTLL----MQQRIDSFQYHNDFIYWLTPHG 243

  Fly   268 ERFMRKSM------DYVLSQRAES----------GENRH-DLIDIFLQLKRTEPAESIIHRPDF- 314
            .||:|...      |:|:.||..:          .|.|| |.:||.|..:    .||.|...|. 
Mouse   244 RRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGAR----DESGIKLSDAD 304

  Fly   315 FAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLR 379
            ..|:....:..|.||::|.|::.||.:|.....|.|.|.|:|..|......|  .|.:..:.||.
Mouse   305 LRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQ--WDDLAQMTYLT 367

  Fly   380 QVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVF 444
            ..:.|..|||||...:.|..:....:    .:|.|   |.||:.:.:.:..:||::..||:||||
Mouse   368 MCMKECFRLYPPVPQVYRQLSKPVTF----VDGRS---LPAGSLISLHIYALHRNSAVWPDPEVF 425

  Fly   445 DPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDP 509
            ||.|||.|.....||..::||.||||.|||......|:||.....|..|          |...||
Mouse   426 DPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRF----------EFSPDP 480

  Fly   510 K-------AFVLTAHNGTYL 522
            .       ..:|.:.||.:|
Mouse   481 SKIPIKVPQLILRSKNGIHL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 100/401 (25%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 103/408 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.