DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and tbxas1

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_031753608.1 Gene:tbxas1 / 100327243 XenbaseID:XB-GENE-994325 Length:532 Species:Xenopus tropicalis


Alignment Length:551 Identity:145/551 - (26%)
Similarity:244/551 - (44%) Gaps:83/551 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GCLLVVTIV--------WLWQILHFWHWRRLGVPFVPAAPFVGNVWNLLRGACCFGDQFRELYES 83
            ||.:.:|:|        | :.:..||...:.|:......||:||:....:|   |.:..|.|.::
 Frog    11 GCTVTLTLVAGFLGLLYW-YSVSAFWQLEKAGIKHPKPLPFIGNIMLFQKG---FWEGDRHLLKT 71

  Fly    84 KEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETW 148
            .......::|    ....:::.:|..||:::.:||..|::|.:..:.....| |.:|...:.:.|
 Frog    72 YGPICGYYMG----RRPMIVIAEPDAIKQVLQKDFVNFTNRMQRLNLVTKPM-SDSLLCLRDDKW 131

  Fly   149 RETHKIFAPFFAAGKVRNMYGLLENIGQKLEEH-MEQKLSGRDSMELEVKQLCALFTTDIIASLA 212
            :....:..|.|:|.:::.|..|:......|.|: ||...||.   ...|::..|.||.|::||:|
 Frog   132 KRVRSVLTPSFSAARMKEMCPLINQCCDVLVENLMEYASSGE---ACNVQRCYACFTMDVVASVA 193

  Fly   213 FGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMF--------FFPRLSHRVGTHLYSEEYER 269
            ||.:..|.::.:....:.|        ||.|.|||.|        .||.:...:...|.::..:|
 Frog   194 FGTQVDSQRDSDHPLVQNC--------KRFLELFTPFKPVVLLCLAFPSIMIPIARRLPNKHRDR 250

  Fly   270 ----FMRKSMDYV-LSQRAESGENRHDLIDIFLQLKRTEPAESIIH------------------- 310
                |::...|.: ..:.....|.|.|.:.:.|..:.:....|:.|                   
 Frog   251 INSFFLKVIRDIIAFRENQPPNERRRDFLQLMLDARDSAGHVSVDHFDIVNQADLSVPQNQDRGQ 315

  Fly   311 -----------RPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQD 364
                       ..:....||...|:||::|:.|.::||.|.||.:...|::|..|:...  |.:.
 Frog   316 DPPRKSTQKTLNEEEILGQAFIFLIAGYETTCSLLSFASYLLATHPDCQEKLLKEVDEF--SQEH 378

  Fly   365 RQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVL 429
            .:...:||..|.|:..|::|.||:|||.....|    ....|.:....|.|    ||..|.|.:.
 Frog   379 EEADYNTVHDLPYMEMVINETLRMYPPAYRFAR----EAARDCTVMGLGIP----AGAVVEIPIG 435

  Fly   430 GIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFR 494
            .:..|.::|..||.|:||||:||::|:.||..:||||||||.|||..|..||.|:.|..:|..||
 Frog   436 CLQNDPRFWHEPEKFNPERFTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITLYRVLRKFR 500

  Fly   495 VEVCERTLPEMRFDPKAFVLTAHNGTYLRFV 525
            .:.|:.|...::..... .|...:|.|:|.|
 Frog   501 FQTCDLTQIPLQLSAMT-TLRPKDGVYVRVV 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 124/467 (27%)
tbxas1XP_031753608.1 cytochrome_P450 71..526 CDD:425388 126/481 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.