DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and cyp4f3

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001083010.1 Gene:cyp4f3 / 100037390 ZFINID:ZDB-GENE-070410-108 Length:511 Species:Danio rerio


Alignment Length:423 Identity:106/423 - (25%)
Similarity:172/423 - (40%) Gaps:76/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLS-GRDSMELEVKQLCALF 203
            |.....:.|....::..|.|....::....:.......:.:...:.|: |..|::: .:|:.:| 
Zfish   121 LLLQSGQEWSRHRRLLTPAFHFDILKKYVHIFNQSTNIMHDEWRRLLAKGEHSVDM-FEQISSL- 183

  Fly   204 TTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTH---LY-- 263
            |.|.:....|..:.||.:.|. ::....::::     |||        .:..|.:..|   ||  
Zfish   184 TLDSLLKCTFSCDTHSQEKPR-QYISAILDLS-----RLL--------VQRQHYLPYHWDWLYWR 234

  Fly   264 SEEYERFMRK-------SMDYVLSQRAE-------------SGENRH----DLIDIFLQLKRTEP 304
            |.:..||.:.       :.|.|..:|.:             :|..|.    ||||:.| |.:.:.
Zfish   235 SAQGRRFQQACAVVHQFTADIVQERRTQLDQQSDPESHPENTGRYRKRKNTDLIDLLL-LAKDDK 298

  Fly   305 AESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSC 369
            .|.:.:  :...|.|...:.||.||::|.:::..|.||.|...|:|.|.|:|..|.......:..
Zfish   299 GEGLTN--EEIKAHADMFMFAGHDTTASALSWIFYNLAMNQDYQERCRAEVRDLLADRDTHTIGW 361

  Fly   370 DTVTGLVYLRQVVDEVLRLYPPTAFLDR--CCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIH 432
            :.::.|.:....:.|.|||:.|...|.|  ..|.:|..|.         .:..|....||:.|:|
Zfish   362 EDLSQLTFTTMCIKESLRLHSPVLALTRYYSQNMKTPGDC---------VIPHGCLCLISIYGVH 417

  Fly   433 RDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEV 497
            |:.|.||:|.||||.||.........|..::||.||||.|||......|:||.:...|..|::  
Zfish   418 RNPQVWPDPLVFDPTRFDPHNSDSRSPHAFIPFSAGPRNCIGQNFAMAEMKVVVALTLARFKI-- 480

  Fly   498 CERTLPEMRFDPK------AFVLTAHNGTYLRF 524
                ||    .||      ..||.|..|..|.|
Zfish   481 ----LP----GPKPVRRLYQLVLRAEGGMILHF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 101/412 (25%)
cyp4f3NP_001083010.1 p450 38..503 CDD:278495 104/419 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.