DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir20a and Ir56d

DIOPT Version :9

Sequence 1:NP_608456.1 Gene:Ir20a / 33126 FlyBaseID:FBgn0031181 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster


Alignment Length:447 Identity:96/447 - (21%)
Similarity:174/447 - (38%) Gaps:119/447 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FLHK-LDDLRGHRLR--VIPDLSPPNTFFYRDARGDNQVTGYLWDFLATFAGRLNAG-LEVVRPS 237
            |.|| ..:::|:.:|  ::.|:  |..|     :.|.....|..:|:...:|.|..| ||.|..:
  Fly   203 FFHKYAKNMKGYLVRTPILYDM--PRVF-----KSDRPTNRYEKNFIHGTSGNLFLGFLEFVNAT 260

  Fly   238 WRAGSAS-DSSYMLEYSAKGLIDVGLTTTLI-------TKWNLWAIHQYTYPLLVSSWCTMLPVE 294
            ....||: .:.|:...:...|:..|:..|||       ||:    :..|:||:.::..|.|:|..
  Fly   261 LMDTSANVTADYLNMTNLLDLVSQGVYETLIHSFTEITTKF----VVSYSYPIGINDCCIMVPYR 321

  Fly   295 -----------------------------------KPLATPDL---FGRIVC------------- 308
                                               .||...||   |.:.:|             
  Fly   322 NQSPADQYMHEALQENVWVLISLFTLYITVAIYLCSPLRPRDLSAAFLQSICTLTYSVPTFIIRT 386

  Fly   309 PTLAMTLLLIILVTWLVFRQLRCLTRLKNSRPARIVPHLLTLLLLTTCSAQLLSLLIFPPYHVRI 373
            |||.|..|.|:|..|.:......::|:.:              ..||.          ||.. :|
  Fly   387 PTLRMRYLYILLAIWGIVTSNLYISRMTS--------------YFTTA----------PPVR-QI 426

  Fly   374 ASFEDLLRGDQKILGMRNEFYNFDGA---FRARYAGVFYLIDDPNELYDL-RNHFNTTWAYTMPY 434
            .:.:|::..:.:|..:..|:.....:   :...|.....|:|  ..:.|| |:.|||::.||:..
  Fly   427 NTVQDVVEANLRIKMLAIEYERMAKSPLQYPESYLNQVDLVD--KHMLDLHRDPFNTSFGYTVSS 489

  Fly   435 IKWLVIKTQQRHFSKPLFRWSKDLC---FFDFMPTSVIVAPDSIYWESIKDFTFRIHQAGLMKHW 496
            .:|..:..||.|..||:||.: ::|   |:...|    :..||.....:.::.....|||||.||
  Fly   490 DRWRFLNLQQLHLRKPIFRLT-EICEGPFYHVFP----LHKDSHMRSVMTEYIMIAQQAGLMNHW 549

  Fly   497 IRKSFYDMIKAGKMSIKDYSDLETLKP--LNIGDLEIVWRVCGAAIAVASAIFIMEL 551
            .|::|::.:...::.:..:.|    :|  |::.....:.|.....:.:|...|..|:
  Fly   550 ERETFWEAVHLHRIHVHLFDD----EPMALSLDFFSSLLRTWTLGLILAGLAFAAEM 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir20aNP_608456.1 None
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 20/133 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJJD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.