DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir20a and Ir56b

DIOPT Version :9

Sequence 1:NP_608456.1 Gene:Ir20a / 33126 FlyBaseID:FBgn0031181 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:444 Identity:92/444 - (20%)
Similarity:162/444 - (36%) Gaps:145/444 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 PSFELVMRWISVGQGVKLFLHKLDDLRGHRLRVIPDLSPPNTFFYRDARGDNQVTGYLWDFLATF 223
            |..|:|..:..| ...:|||..|:.|            |..:...:|                ..
  Fly    39 PYMEIVKHFAEV-YHYQLFLDSLESL------------PKKSVVEQD----------------II 74

  Fly   224 AGRLNAGLE--VVRPSWRAGSASDSSYMLEYSAKGLIDVGLTTTLITKWNLWAIHQYTYPLLVSS 286
            :|:.|..|.  ::||.    ..||                          .:...|::|||.:.:
  Fly    75 SGKYNLSLHGVIIRPE----ETSD--------------------------FFNATQHSYPLELMT 109

  Fly   287 WCTMLPVEKPLATPDL---------FGRIVCPTLAM-TLLLIILVTWLVFRQLRCLTRLKNSRPA 341
            .|.|:|:     .|:|         .|:.:...|.: |..:.:|:.::.:|:....||    ...
  Fly   110 NCVMVPL-----APELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATR----SYT 165

  Fly   342 RIVPHLLTLLLLT---TCSAQL----LSLLIF-----------PPYHVR--------------IA 374
            |.|.|.:.||:.:   ..|.:|    :.::||           ..||:.              |.
  Fly   166 RNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPID 230

  Fly   375 SFEDLLRGDQKIL---GMRNEFYNFDGAFRARYAGVFY-LIDDPNELYDLRNHFNTTWAYTMPYI 435
            ::.||:....:|:   .:..|.         |:..|:. |:..|:..|          ||.:...
  Fly   231 TWSDLIHSRLRIVIHDSLLEEL---------RWLPVYQALLASPSRSY----------AYVVTQD 276

  Fly   436 KWLVIKTQQRHFSKPLFRWSKDLCF---FDFMPTSVIVAPDSIYWESIKDFTFRIHQAGLMKHWI 497
            .||....||:...:|.|..|| :||   |:.:|    :|.::.:.:|:..|...:.||||..:|.
  Fly   277 AWLFFNRQQKVLIQPYFHLSK-VCFGGLFNALP----MASNASFADSLNKFILNVWQAGLWNYWE 336

  Fly   498 RKSFYDMIKAGKMSIKDYSDLETLKPLNIGDLEIVWRVCGAAIAVASAIFIMEL 551
            ..:|....:||...:  :.|...::|||:......|.|..|.|.::|..|.:||
  Fly   337 ELAFRYAEQAGYAKV--FLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLEL 388



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJJD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.