DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir20a and Ir48c

DIOPT Version :9

Sequence 1:NP_608456.1 Gene:Ir20a / 33126 FlyBaseID:FBgn0031181 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_610700.1 Gene:Ir48c / 36257 FlyBaseID:FBgn0033651 Length:561 Species:Drosophila melanogaster


Alignment Length:427 Identity:96/427 - (22%)
Similarity:161/427 - (37%) Gaps:97/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DLRGHRLRVIPDLSPPNTFFYRD--ARGDNQVTGYLWDFLATFAGRLNAGLEVVRP--SWRAGSA 243
            :|.|:.|||:....||:.|..:|  ....|:..|.:...|..||.:|||..: ..|  .:|..|.
  Fly   172 NLMGYPLRVLVTNDPPHCFVDKDELPGSPNRYKGSIVTMLKIFADQLNATFQ-ANPFREFRRYST 235

  Fly   244 SDSSYML---EYSAKGLIDVGLTTTLITKWNLWAIHQYTY----PLLVSSWCTMLPVEKPLA--- 298
            :|...|:   |..|.|.|               .|..|||    |:.::....|.|...|:.   
  Fly   236 ADCVQMVSDDEIDACGSI---------------FIRTYTYATSQPVRLNRVVIMAPFGNPIEKFY 285

  Fly   299 ---TP-DLF-----GRIVCPTLAMTLL--------------LIILVTWLVFRQLRCLTRLKNSRP 340
               .| ||:     |.||.....|..|              |::.|..|:.|:|........|: 
  Fly   286 YFFRPFDLYVWIGTGIIVVYIAVMGSLLHRWHFKEWNVGQYLLLAVQTLLNRELSLPQSSSGSK- 349

  Fly   341 ARIVPHLLTLLL------LTTCSAQLLSLLIFPPYHVR-IASFEDLLRGDQKIL----GMR-NEF 393
                 .:|.|||      |:.....|||:::....:.| |.:..||...:..||    .:| |..
  Fly   350 -----FMLLLLLFAIGFILSNLYVALLSMMLTTKLYQRPIENLADLKAANVNILLQTHNIRPNSV 409

  Fly   394 YNFDGAFRARYAGVFYLIDDPNELYDLRNHFNTTWAYT--------MPYIKWLVIKTQQRHFSKP 450
            |......|.|    |.|:::...| :.||..:.::||.        ..|.:..:.:.:.:..|.|
  Fly   410 YGSSEELRER----FLLVEESQHL-EKRNGLDPSYAYVDSEDRMDFYLYQQKFLRRRRMKKLSNP 469

  Fly   451 L-FRWSKDLCFFDFMPTSVIVAPDSIYWESIKDFTFRIHQAGLMKHWIRKSFYDMIKAGKMSIKD 514
            : :.|:..           ::..:.:..:...|...|..:.||....:.......:|||.:....
  Fly   470 VGYTWAVQ-----------VIKQNWVLEKHYNDHVQRFFETGLQNKLVDDVHELAVKAGFLHFFP 523

  Fly   515 YSDLETLKPLNIGDLEIVWRVCGAAIAVASAIFIMEL 551
             :..:|::||.:.|:.:...|.|...|:|...|::||
  Fly   524 -TQTQTIEPLRLEDIVMAAMVLGGGHALAVICFLVEL 559



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.