DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir20a and Ir10a

DIOPT Version :9

Sequence 1:NP_608456.1 Gene:Ir20a / 33126 FlyBaseID:FBgn0031181 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster


Alignment Length:615 Identity:127/615 - (20%)
Similarity:219/615 - (35%) Gaps:168/615 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LWQRNLTAH-----PQIVW--------------QRNYSYPDLYYQFNAKLLVL------------ 82
            ||.|..:.|     |.:.|              |.|..:.|  ..|..:.|||            
  Fly    39 LWLRAGSDHQDAENPYVQWFLLRTEIPLSIVTYQENRYWMD--DPFGRRNLVLVMSLDQLLTNRG 101

  Fly    83 ACLPMDSRAAIQLEILANSLSHLRTVVRLLIEVAGPDQVTLARQYLSFCLRRSMLHVELYFRDYH 147
            |..|: .:|:....|||:....|....:|.:|.:.....|..:.|..|.|.|..:.:...|:   
  Fly   102 AAAPI-QKASTFFYILADQDKDLSADEQLRLEGSCRQLWTQHKVYNRFFLTRDGVWIYDPFK--- 162

  Fly   148 HSLILYSFRAFPSFELVMRWISVGQGVKLFLHKLDDLRGHRLRV--------IPDLSPPNTFFYR 204
                    |...:|..::|:.......||...   |:.|:.||:        .|:.........|
  Fly   163 --------RRDSAFGRLVRYYGSETLDKLLFR---DMAGYPLRIQMFRSVYTRPEFDKETGLLTR 216

  Fly   205 DARGDNQVTGYLWDFLAT--FAGRLNAGLEVVRPSWRAGSASDSSYMLEYSAKGL---------- 257
                   |||.  |||..  ...|||..:.:.:|        :..|..|.||.|.          
  Fly   217 -------VTGV--DFLVAQMLRERLNFTMLLQQP--------EKKYFGERSANGSYNGAIGSIIK 264

  Fly   258 --IDVGLTTTLITKWNLWAIHQYTYPLLVSSWCTMLPVEK--PLATPDLFG------------RI 306
              :|:.||...:..:.:.....:|..:.....|..:|...  |.:...:|.            ..
  Fly   265 DGLDICLTGFFVKDYLVQQYMDFTVAVYDDELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAF 329

  Fly   307 VCPTLAMTLLLI--------------------ILV-TWLVFRQLRCLTRLKNSRPARIVPHLLTL 350
            .|..:.:||.:|                    |:| ||:|:.:|. |:.|..|...|:  .:.||
  Fly   330 ACALIWLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVVWVRLN-LSHLPASYAERM--FIGTL 391

  Fly   351 LLLTTC-----SAQLLSLLIFPPYHVRIASFEDLLRGDQKILGMRNEFYNF----DGAFRARYAG 406
            .|::..     .:.|.::.|.|.|:..|.:.::|.....|::      |.:    |..|.:..:.
  Fly   392 CLVSVIFGAIFESSLATVYIHPLYYKDINTMQELDESGLKVV------YKYSSMADDLFFSETSP 450

  Fly   407 VFYLI------------DDPNELYDLRNHFNTTWAYTMPYIKWLVIKTQQRHFSKPLFR--WSKD 457
            :|..:            |..:|:...||....: .||.     |::::.  ||:  |.|  |...
  Fly   451 LFASLNKKLSWNRDLRADVIDEVARFRNKAGVS-RYTS-----LILESS--HFT--LLRKIWVVP 505

  Fly   458 LCFFDFMPTSVIVAPDSIYWESIKDFTFRIHQAGLMKHWIR--KSFYDMIKAGKMSIKDYSDLET 520
            .| ..:...|.::..||.:.:::.....|...|||:..||:  ||:.| ||.....::..::.|.
  Fly   506 EC-PKYYTISYVMPRDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVD-IKMRSNILEADAESEL 568

  Fly   521 LKPLNIGDLEIVWRVCGAAIAVASAIFIME 550
            ::.|.||||::.:.|......:|...|:.|
  Fly   569 VRVLTIGDLQLAFYVVIGGNLLAFLGFLAE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir20aNP_608456.1 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 16/83 (19%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 18/98 (18%)
Lig_chan 319..587 CDD:278489 62/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.