DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and MFAP3L

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_005263423.1 Gene:MFAP3L / 9848 HGNCID:29083 Length:442 Species:Homo sapiens


Alignment Length:237 Identity:54/237 - (22%)
Similarity:88/237 - (37%) Gaps:81/237 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 WTLNIR--------GVKMEDAGKY--------MCQVNTDPMKMQTATLEVVIPPDIINEETSG-- 220
            |...:|        |.:.|.|.|.        :|.:.:.|..:..:||...  ..:.|...:|  
Human    11 WRGGVRFLLKYQLYGPRTEQAKKMDRLKSHLTVCFLPSVPFLILVSTLATA--KSVTNSTLNGTN 73

  Fly   221 --------------DMMVPEGGSAKLVCRARGHPKPKITW---------RREDGREIIARNGSHQ 262
                          .::|.||.||.:.|...|.|.|:..|         ..||.:|   |.|.  
Human    74 VVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKE---RGGG-- 133

  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHF----------------HP 311
              |.|..:..:|.::|::.|:.|.|.|:||| :..||:..:.|:|.|                ..
Human   134 --KWQMHDSGLLNITKVSFSDRGKYTCVASN-IYGTVNNTVTLRVIFTSGDMGVYYMVVCLVAFT 195

  Fly   312 LVQVPNQLVGAPVLTDVTLIC----NVEASPKAINYWQRENG 349
            :|.|.|          :|.:|    :::.:.||||.:.|..|
Human   196 IVMVLN----------ITRLCMMSSHLKKTEKAINEFFRTEG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 10/50 (20%)
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/12 (17%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 31/120 (26%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/12 (8%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 8/27 (30%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 2/4 (50%)
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
MFAP3LXP_005263423.1 Ig_3 80..162 CDD:464046 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.