DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CD86

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:317 Identity:56/317 - (17%)
Similarity:111/317 - (35%) Gaps:94/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LAIHEHVITNNDRLSVQHNDY--------NTWTLNIRGVKMEDAGKYMC---------QVNTDPM 198
            |.::| |....::....|:.|        ::|||.:..::::|.|.|.|         .:....|
Human    63 LVLNE-VYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQM 126

  Fly   199 KMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRA-RGHPKPK---ITWRREDGREIIARNG 259
            ..:.:.|.....|:|:....     :.|.....|.|.: .|:|:||   :..|.::  ..|..:|
Human   127 NSELSVL
ANFSQPEIVPISN-----ITENVYINLTCSSIHGYPEPKKMSVLLRTKN--STIEYDG 184

  Fly   260 SHQKTKAQSVEGEMLTLS-KITRSEMGAYM---CIASNGVPPTVSKRMKLQVHFHPLVQVPNQLV 320
            ..||::....|...:::| .::..::.:.|   ||........:|....:::. .|  |.|...:
Human   185 VMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILE
TDKTRLLSSPFSIELE-DP--QPPPDHI 246

  Fly   321 GAPVLTDV--TLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSD 383
              |.:|.|  |:|..|......:..|:::                             ||.::| 
Human   247 --PWITAVLPTVIICVMVFCLILWKWKKK-----------------------------KRPRNS- 279

  Fly   384 FGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSR 440
               |||                     |...:..::..:..|.|.:....||::..|
Human   280 ---YKC---------------------GTNTMEREESEQTKKREKIHIPERSDEAQR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 14/74 (19%)
ig 102..195 CDD:278476 12/60 (20%)
IG_like 219..307 CDD:214653 18/95 (19%)
Ig 221..307 CDD:299845 18/93 (19%)
Ig 311..404 CDD:299845 16/94 (17%)
IG_like 327..405 CDD:214653 11/79 (14%)
CD86NP_787058.5 IgV_CD86 28..133 CDD:319336 13/70 (19%)
Ig 136..221 CDD:325142 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.