DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CD80

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_005182.1 Gene:CD80 / 941 HGNCID:1700 Length:288 Species:Homo sapiens


Alignment Length:253 Identity:56/253 - (22%)
Similarity:97/253 - (38%) Gaps:72/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTW----- 174
            ||.:|      ||.||.: ..|..::.|.| :.|.:             |::...|.|.|     
Human    46 ATLSC------GHNVSVE-ELAQTRIYWQK-EKKMV-------------LTMMSGDMNIWPEYKN 89

  Fly   175 ----------TLNIRGVKMEDAGKYMCQV---NTDPMKMQ-----TATLEVVIPPDIINEETSGD 221
                      ::.|..::..|.|.|.|.|   ..|..|.:     |.:::...|...|:     |
Human    90 RTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVK
ADFPTPSIS-----D 149

  Fly   222 MMVPEGGSAKLVC-RARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSK---ITRS 282
            ..:|.....:::| .:.|.|:|.::| .|:|.|:.|.|    .|.:|..|.|:..:|.   ...:
Human   150 FEIPTSNIRRIICSTSGGFPEPHLSW-LENGEELNAIN----TTVSQDPETELYAVSSKLDFNMT 209

  Fly   283 EMGAYMCIASNG---VPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLT-----DVTLIC 332
            ...::||:...|   |..|.:.....|.||      |:.|:.:..:|     .:.:||
Human   210 TNHSFMCLIKYGHLRVNQTFNWN
TTKQEHF------PDNLLPSWAITLISVNGIFVIC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 24/116 (21%)
ig 102..195 CDD:278476 21/97 (22%)
IG_like 219..307 CDD:214653 22/94 (23%)
Ig 221..307 CDD:299845 22/92 (24%)
Ig 311..404 CDD:299845 5/27 (19%)
IG_like 327..405 CDD:214653 2/6 (33%)
CD80NP_005182.1 IgV_CD80 35..139 CDD:319335 24/113 (21%)
IgC_CD80 142..232 CDD:319332 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.