DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr21

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:97/233 - (41%) Gaps:32/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRL-SVQH 168
            :|||...|......|.:.|||...||           ||:.....:|.:.|...|::.|. |:.:
  Fly    59 KNVTSLVGITGHLNCRIKNLGNKTVS-----------WIRHRDLHLLTVSESTYTSDQRFTSIYN 112

  Fly   169 NDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG-DMMVPEGGSAKL 232
            .....|:|.|:..::.|:|.|.|||:|.|....|....||.|   |.....| ::.:..|.:..|
  Fly   113 KQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEP---ITSILGGPEIYIDLGSTVNL 174

  Fly   233 VCRARGHPKPKIT--WRREDGREI---IARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIAS 292
            .|..:..|.|.|:  | ..:.:||   ..|.|....|:...:....|.:.:.:.::.|.|.|:.|
  Fly   175 TCVIKHLPDPPISVQW-NHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPS 238

  Fly   293 NGVPPTVSKRMKLQVHF----HPLVQVPNQLVGAPVLT 326
            |....:|:      ||.    ||.....:.|:.:.:|:
  Fly   239 NANSKSVN------VHILKGDHPAAVQKSHLLVSELLS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 30/104 (29%)
ig 102..195 CDD:278476 26/90 (29%)
IG_like 219..307 CDD:214653 20/93 (22%)
Ig 221..307 CDD:299845 19/90 (21%)
Ig 311..404 CDD:299845 3/16 (19%)
IG_like 327..405 CDD:214653 59/233 (25%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 25/88 (28%)
IG_like 71..140 CDD:214653 22/79 (28%)
IG_like 162..249 CDD:214653 20/93 (22%)
IGc2 169..242 CDD:197706 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.