DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and PDCD1LG2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_005251657.1 Gene:PDCD1LG2 / 80380 HGNCID:18731 Length:283 Species:Homo sapiens


Alignment Length:218 Identity:43/218 - (19%)
Similarity:75/218 - (34%) Gaps:74/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136
            ::.|||:     |::..::..:.|.. ...:|.|...|..|.:.|..|..:. |.|...|..:::
Human     1 MIFLLLM-----LSLELQLHQIAALF-TVTVPKELYIIEHGSNVTLECNFDT-GSHVNLGAITAS 58

  Fly   137 PAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTW----------TLNIRGVKMEDAGKYMC 191
            ..||                   .||  :..|.:..|.          :.:|..|::.|.|:|.|
Human    59 LQKV-------------------END--TSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQC 102

  Fly   192 ---------------QVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPK 241
                           :|.....|:.|..|:                 |||....:|.|:|.|:|.
Human   103 IIIYGVAWDYKYLTLKVKASYRKINTHILK-----------------VPETDEVELTCQATGYPL 150

  Fly   242 PKITWRREDGREIIARNGSHQKT 264
            .:::|....    :..|.||.:|
Human   151 AEVSWPNVS----VPANTSHSRT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 25/135 (19%)
ig 102..195 CDD:278476 22/117 (19%)
IG_like 219..307 CDD:214653 13/46 (28%)
Ig 221..307 CDD:299845 13/44 (30%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
PDCD1LG2XP_005251657.1 Ig 26..>103 CDD:299845 20/98 (20%)
IG_like 35..119 CDD:214653 18/105 (17%)
Ig 137..193 CDD:299845 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.