DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and VTCN1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011540445.2 Gene:VTCN1 / 79679 HGNCID:28873 Length:332 Species:Homo sapiens


Alignment Length:268 Identity:52/268 - (19%)
Similarity:90/268 - (33%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPA 138
            ::::|...|.|.:...||...:.....|....|:    |.|...:|.        ...|...:..
Human    65 IIIILAGAIALIIGFGISGRHSITVTTVASAGNI----GEDGILSCT--------FEPDIKLSDI 117

  Fly   139 KVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWT-------------LNIRGVKMEDAGKYM 190
            .:.|:|   :.:|.:........|.||.|...:...|             |.::.|::.|||.|.
Human   118 VIQWLK---EGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYK 179

  Fly   191 CQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPE------GGSAKLVCRA-RGHPKPKITWRR 248
            |.:.|...| ..|.||.          .:|...:||      ..|..|.|.| |..|:|.:.|..
Human   180 CYIITSKGK-GNANLEY----------KTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWAS 233

  Fly   249 EDGREIIARNGSHQKTKAQSVEGEMLTLSKIT----RSEMGAYMCIASNGVPPT----------V 299
            :..:   ..|.|.....:..:..|.:|:..::    .:....|.|:..|.:...          :
Human   234 QVDQ---GANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEI 295

  Fly   300 SKRMKLQV 307
            .:|..||:
Human   296 KRRSHLQL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 26/123 (21%)
ig 102..195 CDD:278476 20/105 (19%)
IG_like 219..307 CDD:214653 20/108 (19%)
Ig 221..307 CDD:299845 19/106 (18%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
VTCN1XP_011540445.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.