DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and opcml

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml / 779942 XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis


Alignment Length:332 Identity:96/332 - (28%)
Similarity:150/332 - (45%) Gaps:50/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LTVSNKISSVGAFEPDFVIP--LENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKAD 146
            |||...|:.|.....|...|  ::|||:.||..|...|.|:|    ||:        :|||:  :
 Frog    22 LTVLLSITGVPVRSGDAGFPKAMDNVTVRQGDSAILRCTVDN----RVT--------RVAWL--N 72

  Fly   147 AKAILAIHEHVITNNDRLSVQ------HNDYNTWTLNIRGVKMEDAGKYMCQVNTD--PMKMQTA 203
            ...||      .|.||:.|:.      .|..:.:::.|:.|.:.|.|.|.|.|.||  | |....
 Frog    73 RSTIL------YTGNDKWSIDPRVVLLANTKSQYSIEIQNVDIYDEGPYTCSVQTDNHP-KTSRV 130

  Fly   204 TLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQS 268
            .|.|.:.|.|:|  .|.|:.|.||.:..|.|.|.|.|:|.:|||...|:       ||:...   
 Frog   131 HLIVQVAPQILN--ISSDITVNEGSTVALRCLATGRPEPAVTWRHFTGK-------SHRFVS--- 183

  Fly   269 VEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICN 333
             :.|.|.::.|||.:.|.|.|.|:|.|.....:::::.|::.|.:. ..:..||.:.....|.|:
 Frog   184 -DDEYLEITGITRDQSGQYECSAANDVSAPDIRKVRVTVNYPPYIS-DTRNTGASLGQKGILRCS 246

  Fly   334 VEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDT 398
            ..|.|.|...|.||...:....|...:..|::     ..||....:...|:|.|.|::.|.:|::
 Frog   247 ASAVPLAEFQWYREETRLANGLDGVRIENKDH-----MSILTFFNVSEKDYGNYTCVASNKLGNS 306

  Fly   399 EGTIRLY 405
            ..::.||
 Frog   307 NASVILY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 36/120 (30%)
ig 102..195 CDD:278476 29/100 (29%)
IG_like 219..307 CDD:214653 28/87 (32%)
Ig 221..307 CDD:299845 27/85 (32%)
Ig 311..404 CDD:299845 21/92 (23%)
IG_like 327..405 CDD:214653 18/77 (23%)
opcmlNP_001072487.1 Ig 46..134 CDD:325142 33/108 (31%)
Ig_3 138..207 CDD:316449 29/81 (36%)
ig 228..312 CDD:278476 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.