DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and zgc:153911

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001070783.1 Gene:zgc:153911 / 768172 ZFINID:ZDB-GENE-061013-174 Length:288 Species:Danio rerio


Alignment Length:279 Identity:52/279 - (18%)
Similarity:94/279 - (33%) Gaps:76/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 ITWRR--------EDGREIIARNGSHQKTKAQSVEGEM------LTLSKITRSEMGAYMC-IASN 293
            |||:|        ...|:.:.|...|..::......||      |.|.|:|:.:.|.|.| |::|
Zfish    57 ITWQRGLDVVHSFYYSRDQLDRQNPHYVSRTSLFIQEMQRGNASLKLDKVTQRDAGVYTCSISTN 121

  Fly   294 GVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTD-VTLICNVEAS-PKAINYWQRENGEMIIAGD 356
                :.|::....|:...|...|.  :...:||| |.|:...:.. |.....|..||.::.....
Zfish   122 ----SGSQKKSFAVNI
AALYSEPR--LQFSMLTDGVNLLVTSDGGYPSPTLQWLMENSDITNQTQ 180

  Fly   357 RYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLN 421
            .:...:....:|.:...:.:..:.:|                                    .|.
Zfish   181 THLRQDTSTGLYIVSSWIKLSDVSNS------------------------------------SLT 209

  Fly   422 EVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVLFTAL 486
            .:..|:.:.:|.|.|.       :|..|:...|.....|:..:    :..:...|||:::||...
Zfish   210 FILHNKPLGQDIRREI-------QLSSDKIEKQEENRCSECFI----LIPVALLLLAMVLLFVFF 263

  Fly   487 ------AEAGPTTLSCRTK 499
                  ||....:.|..||
Zfish   264 IKRRRKAEKSKQSSSSETK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352
ig 102..195 CDD:278476
IG_like 219..307 CDD:214653 19/77 (25%)
Ig 221..307 CDD:299845 19/77 (25%)
Ig 311..404 CDD:299845 13/94 (14%)
IG_like 327..405 CDD:214653 9/79 (11%)
zgc:153911NP_001070783.1 V-set 28..122 CDD:284989 18/68 (26%)
IG_like 35..133 CDD:214653 20/79 (25%)
Ig <156..221 CDD:299845 8/100 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.