DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and zgc:152904

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001428928.1 Gene:zgc:152904 / 767777 ZFINID:ZDB-GENE-060929-856 Length:840 Species:Danio rerio


Alignment Length:317 Identity:82/317 - (25%)
Similarity:133/317 - (41%) Gaps:58/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLE--NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITN 160
            |...:|.:  |.|.......|||||.:          ||..| :|.|....         |.|.:
Zfish   208 PVLSVPQQSFNATADYQESVTFTCVTS----------GSPDP-QVTWYWKG---------HAIEH 252

  Fly   161 NDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTAT-LEVVIPPDIINEETSGDMMV 224
            :::..:...:....||.::.:|..|.|.|||:.:......::.. |:|.:.|.|....   ::..
Zfish   253 SEQYVLNTMNGGKSTLTVKNIKQTDGGPYMCRASNKAGSSESQLFLKVFVQPHITQLR---NVTA 314

  Fly   225 PEGGSAKLVCRARGHPKPKITWRR-EDGREIIARNGSHQKTKAQSVEG----EMLTLSKITRSEM 284
            .||.:|.:.|.|.|.|.|:|:||| .||...  .:|...|.....|.|    .|||:|.:..|:.
Zfish   315 VEGSAAMISCTAEGEPLPEISWRRASDGHSF--TDGEKSKDGRVEVRGRHGKSMLTISGVQLSDW 377

  Fly   285 GAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLV-----GAPVLTDVTLICNVEASPKAINYW 344
            |.:.|.|.:.:... .|.|.|.:.:.|..|. ||.:     |.|    |.:.|.|:::|.|...|
Zfish   378 GRFDCEALSRIGGH-QKSMFLDIEYAPKFQT-NQSIFYSWEGNP----VNISCEVKSNPAATMLW 436

  Fly   345 QRENGEMIIAGDRYALTEKENNMYAI-----EMILHIKRLQSSDFGGYKCISKNSIG 396
            :||         |:.::.:..:...|     ..:|.:..:...|||.|.|.::|:||
Zfish   437 RRE---------RFTISSQGTSNIRIHSTDGRSLLEVTPVSDRDFGRYNCTARNNIG 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 26/113 (23%)
Ig strand B 115..119 CDD:409353 2/3 (67%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 0/3 (0%)
Ig 211..307 CDD:472250 31/100 (31%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 1/4 (25%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 19/75 (25%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 2/15 (13%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353
zgc:152904NP_001428928.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.