DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ceacam18

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_017167815.1 Gene:Ceacam18 / 72431 MGIID:1919681 Length:412 Species:Mus musculus


Alignment Length:276 Identity:62/276 - (22%)
Similarity:105/276 - (38%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAK-VAW-----------IKADAKAILAIHEHV 157
            ||||.| |........||:.|.:.|..|.|:...: ..|           |.|:..|::...:.|
Mouse   130 ENVTRA-GSLVVRMSAVNDTGYYTVEVDTSNETQRATGWLQIVKLRSNPGISANTSALVEGMDSV 193

  Fly   158 I----TNNDRLS-----VQHNDYNTWTLNIRG--VKMEDAGKY----MCQVNTDP---MKMQTAT 204
            :    ||:..:|     |..:..|..|::..|  :.:....:|    .|.:...|   .|.:...
Mouse   194 VAKCLTNSSNISWYVNFVPTSGSNRMTISPDGKTLIIHRVSRYDHTLQCAIEDVPEILQKSELIQ 258

  Fly   205 LEVVIPPDIINEET-----SGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKT 264
            |.|...||.::..|     :|.:....|.|.:|.|.....|:|:..|         ..|||.   
Mouse   259 LTVAYGPDYVSLWTQPYFFAGVLTADIGSSVQLECNCFSKPEPRYHW---------IHNGSF--- 311

  Fly   265 KAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFH----------PLVQVPNQL 319
              .|:....:||..::..:||:|.|:..|  |.|       |:.|:          ||..|..:|
Mouse   312 --LSIPENNMTLPSLSWEQMGSYRCVVEN--PET-------QLTFYRDVTIQPPRPPLPTVNREL 365

  Fly   320 -VGAPVLTDVTLICNV 334
             :..|::..:.|:.::
Mouse   366 YIPGPLVIFLILLTSL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 30/133 (23%)
ig 102..195 CDD:278476 26/116 (22%)
IG_like 219..307 CDD:214653 21/87 (24%)
Ig 221..307 CDD:299845 20/85 (24%)
Ig 311..404 CDD:299845 6/25 (24%)
IG_like 327..405 CDD:214653 1/8 (13%)
Ceacam18XP_017167815.1 Ig_CEACAM_D1 68..170 CDD:319315 13/40 (33%)
Ig 283..338 CDD:386229 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.