| Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510620.1 | Gene: | Kirrel3 / 67703 | MGIID: | 1914953 | Length: | 803 | Species: | Mus musculus |
| Alignment Length: | 326 | Identity: | 77/326 - (23%) |
|---|---|---|---|
| Similarity: | 133/326 - (40%) | Gaps: | 70/326 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 103 PLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAI-----LAIHEHVITNND 162
Fly 163 RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPD--IINEETSGDMM-V 224
Fly 225 PEGGSAKLVCRA-RGHPKPKITWRREDGREIIARNG-SHQKT-----KAQSVEGEM-LTLSKITR 281
Fly 282 SEMGAYMCIASN-GVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTD--VTLICNVEASPKAINY 343
Fly 344 WQRENGEMI--IAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDT--EGTIRL 404
Fly 405 Y 405 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-beta | NP_001138225.1 | I-set | 98..209 | CDD:254352 | 25/110 (23%) |
| ig | 102..195 | CDD:278476 | 22/96 (23%) | ||
| IG_like | 219..307 | CDD:214653 | 21/97 (22%) | ||
| Ig | 221..307 | CDD:299845 | 20/95 (21%) | ||
| Ig | 311..404 | CDD:299845 | 25/98 (26%) | ||
| IG_like | 327..405 | CDD:214653 | 19/83 (23%) | ||
| Kirrel3 | XP_006510620.1 | IG_like | 54..143 | CDD:214653 | 24/108 (22%) |
| Ig strand A' | 56..60 | CDD:409353 | 1/3 (33%) | ||
| Ig strand B | 64..71 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 78..82 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 97..101 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 104..116 | CDD:409353 | 5/17 (29%) | ||
| Ig strand G | 132..143 | CDD:409353 | 2/10 (20%) | ||
| IgI_2_KIRREL3-like | 149..246 | CDD:409416 | 23/105 (22%) | ||
| Ig strand B | 166..170 | CDD:409416 | 1/3 (33%) | ||
| Ig strand C | 180..184 | CDD:409416 | 1/3 (33%) | ||
| Ig strand E | 210..214 | CDD:409416 | 0/3 (0%) | ||
| Ig strand F | 224..229 | CDD:409416 | 1/4 (25%) | ||
| Ig strand G | 239..242 | CDD:409416 | 0/2 (0%) | ||
| Ig | <267..334 | CDD:416386 | 19/82 (23%) | ||
| Ig strand B | 267..274 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 279..286 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C' | 288..291 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 298..302 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 304..310 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 321..334 | CDD:409353 | 4/12 (33%) | ||
| Ig | 335..416 | CDD:416386 | |||
| Ig strand A' | 343..347 | CDD:409353 | |||
| Ig strand B | 350..360 | CDD:409353 | |||
| Ig strand C | 365..371 | CDD:409353 | |||
| Ig strand E | 381..387 | CDD:409353 | |||
| IgI_5_KIRREL3 | 418..515 | CDD:409479 | |||
| Ig strand B | 436..440 | CDD:409479 | |||
| Ig strand C | 450..454 | CDD:409479 | |||
| Ig strand E | 481..485 | CDD:409479 | |||
| Ig strand F | 496..501 | CDD:409479 | |||
| Ig strand G | 509..512 | CDD:409479 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||