DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Tmigd1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:211 Identity:56/211 - (26%)
Similarity:95/211 - (45%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 TDPMKMQTATLEVVIPPD-------IINEETSGDMM-VPEGGSAKLVCRARGHPK-PKITWRRED 250
            |.|::.....|.|:..|.       .:|..|...:: ...|..|.|.|..:.|.: .::.|.|||
Mouse    39 TGPLQACQLLLVVLSLPQGRTSSVLTVNGRTENYILDTQHGVQASLECAVQNHTEDEELLWYRED 103

  Fly   251 GREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGA-YMCIASNGVPPTVSKRMKLQVHFHPLVQ 314
            | .:..:||:  |....||     .:|.|..|:.|. :.|....  ..|||..:.|.|.|.||:.
Mouse   104 G-IVDLKNGN--KINISSV-----CVSPINESDNGVRFTCKLQR--DQTVSVTVVLNVTFPPLLS 158

  Fly   315 VPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRL 379
             .|........:||:|:|||:::|:|...|.:.|..:::...|:.:.:...:..     |.|.::
Mouse   159 -GNGFQTVEENSDVSLVCNVKSNPQAQMMWYKNNSALVLEKGRHQIHQTRESFQ-----LSITKV 217

  Fly   380 QSSDFGGYKCISKNSI 395
            :.||.|.|.||:.:|:
Mouse   218 KKSDNGTYSCIASSSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 4/13 (31%)
ig 102..195 CDD:278476 56/211 (27%)
IG_like 219..307 CDD:214653 24/90 (27%)
Ig 221..307 CDD:299845 24/88 (27%)
Ig 311..404 CDD:299845 23/85 (27%)
IG_like 327..405 CDD:214653 20/69 (29%)
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 20/76 (26%)
Ig strand B 171..175 CDD:409353 2/3 (67%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 1/8 (13%)
Ig strand F 224..229 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.