DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Tmigd1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:211 Identity:56/211 - (26%)
Similarity:95/211 - (45%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 TDPMKMQTATLEVVIPPD-------IINEETSGDMM-VPEGGSAKLVCRARGHPK-PKITWRRED 250
            |.|::.....|.|:..|.       .:|..|...:: ...|..|.|.|..:.|.: .::.|.|||
Mouse    39 TGPLQACQLLLVVLSLPQGRTSSVLTVNGRTENYILDTQHGVQASLECAVQNHTEDEELLWYRED 103

  Fly   251 GREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGA-YMCIASNGVPPTVSKRMKLQVHFHPLVQ 314
            | .:..:||:  |....||     .:|.|..|:.|. :.|....  ..|||..:.|.|.|.||:.
Mouse   104 G-IVDLKNGN--KINISSV-----CVSPINESDNGVRFTCKLQR--DQTVSVTVVLNVTFPPLLS 158

  Fly   315 VPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRL 379
             .|........:||:|:|||:::|:|...|.:.|..:::...|:.:.:...:..     |.|.::
Mouse   159 -GNGFQTVEENSDVSLVCNVKSNPQAQMMWYKNNSALVLEKGRHQIHQTRESFQ-----LSITKV 217

  Fly   380 QSSDFGGYKCISKNSI 395
            :.||.|.|.||:.:|:
Mouse   218 KKSDNGTYSCIASSSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 4/13 (31%)
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 174..178 CDD:409353
Ig strand F 188..193 CDD:409353
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 27/105 (26%)
Ig strand B 230..234 CDD:409353 2/3 (67%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 1/5 (20%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 20/69 (29%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 20/76 (26%)
Ig strand B 171..175 CDD:409353 2/3 (67%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 1/8 (13%)
Ig strand F 224..229 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.