DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and zgc:123297

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001032650.1 Gene:zgc:123297 / 641563 ZFINID:ZDB-GENE-051127-9 Length:318 Species:Danio rerio


Alignment Length:153 Identity:38/153 - (24%)
Similarity:71/153 - (46%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KVAWIKADAK-AILAIHEHVITNNDRLSVQHNDYNTWT-------------LNIRGVKMEDAGKY 189
            :|.|.::|.| :::.::|   .:.||.:.|:..|...|             |.:..||:.|.|:|
Zfish    55 RVEWRRSDLKDSLVHLYE---DHEDRETEQNESYRGRTQLIHPELQRGNASLRLSSVKVSDEGRY 116

  Fly   190 MCQVNTDPMKMQTATLEVVI-----PPDIINEETSGDMMVPEGGSAKLVCRARG-HPKPKITWRR 248
            .|.:.::..|.: ||:::.:     ||.|     :.|...|.|| .:|.|.:.| :|:|.:.|..
Zfish   117 KCIIGSESSKHE-ATVDLTV
EALGWPPVI-----TIDGFNPSGG-LRLQCESEGWYPEPHLEWLN 174

  Fly   249 EDGREIIAR-NGSHQKTKAQSVE 270
            .:|..:... ..:|||....|::
Zfish   175 HEGVSLRPETTETHQKAGMFSIK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 20/83 (24%)
ig 102..195 CDD:278476 17/69 (25%)
IG_like 219..307 CDD:214653 15/54 (28%)
Ig 221..307 CDD:299845 15/52 (29%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
zgc:123297NP_001032650.1 IG_like 33..135 CDD:214653 20/83 (24%)
Ig 36..135 CDD:299845 20/83 (24%)
Ig 141..224 CDD:299845 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.