DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Cd274

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_068693.1 Gene:Cd274 / 60533 MGIID:1926446 Length:290 Species:Mus musculus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:68/155 - (43%) Gaps:25/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VAWIKADAKAILAIHEHVITNNDRLSVQHNDY-------------NTWTLNIRGVKMEDAGKYMC 191
            |.|.|.|.:.|     ..:...:.|..||:::             ....|.|..||::|||.|.|
Mouse    55 VYWEKEDEQVI-----QFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCC 114

  Fly   192 QVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIA 256
            .::......:..||:|..|...||:..|.|   |.....:|:|:|.|:|:.::.|...|.:.:  
Mouse   115 IIS
YGGADYKRITLKVNAPYRKINQRISVD---PATSEHELICQAEGYPEAEVIWTNSDHQPV-- 174

  Fly   257 RNGSHQKTKAQSVEGEMLTLSKITR 281
             :|....|.::: ||.:|.::...|
Mouse   175 -SGKRSVTTSRT-EGMLLNVTSSLR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 20/81 (25%)
ig 102..195 CDD:278476 17/67 (25%)
IG_like 219..307 CDD:214653 16/63 (25%)
Ig 221..307 CDD:299845 15/61 (25%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Cd274NP_068693.1 Ig 40..117 CDD:386229 17/66 (26%)
IG 151..225 CDD:214652 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.