DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and DSCAML1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens


Alignment Length:526 Identity:115/526 - (21%)
Similarity:202/526 - (38%) Gaps:120/526 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAK 148
            |::|..: .|....|..:.|.|....:.|:.....|||:       |||   .|.::.|.| |.:
Human   595 LSISQSV-HVAVKVPPLIQPFEFPPASIGQLLYIPCVVS-------SGD---MPIRITWRK-DGQ 647

  Fly   149 AILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMC-QVNTDPMKMQTATLEVVIPPD 212
                    ||.:...::::..::.: :|.|..|.::..|.|.| ..|......:...|.|.:||.
Human   648 --------VIISGSGVTIESKEFMS-SLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPR 703

  Fly   213 IINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQK-------TKAQSVE 270
            .:.:..:.|.:.  |.:..|.|...|:|.||:.|:...|      :|:.|:       .:.|.:.
Human   704 FVVQPNNQDGIY--GKAGVLNCSVDGYPPPKVMWKHAKG------SGNPQQYHPVPLTGRIQILP 760

  Fly   271 GEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDV------T 329
            ...|.:..:...::|.|:|.|||||...:||.|.|      .|::|..:...|..|..      .
Human   761 NSSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFL------TVKIPAMITSHPNTTIAIKGHAKE 819

  Fly   330 LICNVEASPKAINYWQRENGEMIIAGD---RYALTEKENNMYAIEMILHIKRLQSSDFGG---YK 388
            |.|........|..|  |.|:.:|..|   |||:..|:|.    :.::...:|:.:|.|.   :.
Human   820 LNCTARGERPIIIRW--EKGDTVIDPDRVMRYAIATKDNG----DEVVSTLKLKPADRGDSVFFS 878

  Fly   389 CISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDG--------------- 438
            |.:.||.|:..|.|:|...|.|....|   ::.||....:..:.|:..||               
Human   879 CHAINSYGEDRGLIQLTVQEPPDPPEL---EIREVKARSMNLRWTQRFDGNSIITGFDIEYKNKS 940

  Fly   439 --------SRNLNGRLYKDRAPDQHPAS------GSDQLLGRGTMRLIGTFLLALLVLFTALAEA 489
                    :||::..:.:....|.||||      .|...:||....      ..|.:.....|..
Human   941 DSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPS------KELTISTEEAAPD 999

  Fly   490 GP---TTLSCRTKGGRQKKAKETSWNG--RRARDGREDGHAAEWRQCWERSALSWRRSAPPELDY 549
            ||   .||...|     .::.:.:|..  :..::|...|:           .:.:|.::|.....
Human  1000 GPPMDVTLQPVT-----SQSIQVTWKAPKKELQNGVIRGY-----------QIGYRENSPGSNGQ 1048

  Fly   550 YSLIQL 555
            ||::::
Human  1049 YSIVEM 1054

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 25/111 (23%)
ig 102..195 CDD:278476 21/93 (23%)
IG_like 219..307 CDD:214653 26/94 (28%)
Ig 221..307 CDD:299845 26/92 (28%)
Ig 311..404 CDD:299845 26/104 (25%)
IG_like 327..405 CDD:214653 22/89 (25%)
DSCAML1XP_011541219.1 IG_like 43..119 CDD:214653
IGc2 43..110 CDD:197706
Ig 125..218 CDD:299845
IG_like 137..209 CDD:214653
I-set 245..323 CDD:254352
IGc2 252..313 CDD:197706
IGc2 340..401 CDD:197706
I-set 420..514 CDD:254352
Ig 420..510 CDD:299845
IGc2 531..589 CDD:197706
IG_like 619..698 CDD:214653 21/98 (21%)
Ig 627..693 CDD:143165 19/85 (22%)
I-set 702..797 CDD:254352 27/108 (25%)
Ig7_DSCAM 719..797 CDD:143211 24/89 (27%)
I-set 803..896 CDD:254352 25/98 (26%)
Ig 815..903 CDD:299845 25/93 (27%)
FN3 899..993 CDD:238020 18/102 (18%)
FN3 1000..1097 CDD:238020 12/71 (17%)
fn3 1105..1191 CDD:278470
FN3 1203..1294 CDD:238020
IGc2 1318..1382 CDD:197706
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.