DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and DIP-delta

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:390 Identity:169/390 - (43%)
Similarity:232/390 - (59%) Gaps:38/390 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAI 150
            ::|.::.|...||.|..|:.|||:|.||||...|||.:|||:           |||||..|.:.|
  Fly    32 MTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGY-----------KVAWIHIDRQMI 85

  Fly   151 LAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIIN 215
            |.||.|||:...|.|:.:.| |||.|::.....:|.|.|||||||:||..|...|:||:||:|::
  Fly    86 LTIHRHVISRIPRYSITYTD-NTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILD 149

  Fly   216 -EETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKI 279
             |.|...:.|.|..:..:.|||.|.|.|||.||||||.||..    .:|.|....:.::|.|:|:
  Fly   150 IESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAV----EKKKKVLVYDADVLPLTKV 210

  Fly   280 TRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYW 344
            :|:|||||:|||:|||||:||||:.|.|.|.|::.|||||||||..||||:.|:.||.||||.||
  Fly   211 SRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275

  Fly   345 QRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEM-- 407
            . .|..|::...:|. |:...|.|...|.|.|:.||..|||.|:||||||:|:|||:||:||:  
  Fly   276 V-YNSVMVLPSKKYK-TDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL 338

  Fly   408 -ERPGKKIL------RDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLG 465
             ..|.|::.      |::::...|:|:.. |..:::.|....|         |.:|.|.|....|
  Fly   339 PSTPSKQVTHTTVESRENNIIPSSRNDTT-KSLQTDVGYAMKN---------DLYPGSASSSSSG 393

  Fly   466  465
              Fly   394  393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 51/110 (46%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 3/3 (100%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 46/96 (48%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 2/2 (100%)
IG_like 327..405 CDD:214653 39/77 (51%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 3/4 (75%)
Ig strand E 365..376 CDD:409353 4/10 (40%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 2/2 (100%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 48/103 (47%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 3/3 (100%)
Ig strand E 105..112 CDD:409353 5/7 (71%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 46/96 (48%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 2/3 (67%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 3/4 (75%)
Ig strand G 231..234 CDD:409353 2/2 (100%)
Ig 242..333 CDD:472250 49/92 (53%)
Ig strand B 259..263 CDD:409353 2/3 (67%)
Ig strand C 272..276 CDD:409353 2/3 (67%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 2/2 (100%)

Return to query results.
Submit another query.