DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and igsf9bb

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_068072154.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1448 Species:Danio rerio


Alignment Length:332 Identity:87/332 - (26%)
Similarity:117/332 - (35%) Gaps:84/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNN 161
            ||.||......|:..|.|     ||:.|.|.         |..|.|.|........|       |
Zfish    29 EPQFVTSRAGETVILGCD-----VVHPLNGQ---------PYVVEWFKFGVPIPFFI-------N 72

  Fly   162 DRLSVQHND---------YNTWTLNIRGVKMEDAGKYMCQ--------------------VNTDP 197
            .|....|.|         :...:|.|..|:.||.|.|.|:                    ||..|
Zfish    73 FRFYPPHVDPEYAGRASLHGKSSLRIERVRSEDQGWYECKVLMLEQQYHTFHNGSWVHLTVNAPP 137

  Fly   198 MKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQ 262
            ....|       ||..:..:        ||||..|.|.|.|:|||.::|.||.       |....
Zfish   138 TFTDT-------PPQYVEAK--------EGGSITLSCTAFGNPKPSVSWLREG-------NPVQD 180

  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTD 327
            .||.:..:|. |||..|:|.:.|||.|.|.:.....| ...:|.|...|.:..|.:.:...:..|
Zfish   181 STKYKVSDGS-LTLVSISREDRGAYTCRAYSEQGEAV-HTTRLLVQGPPFIVSPPENITVNISQD 243

  Fly   328 VTLICNVEASPKAINY---WQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKC 389
            ....|..||.|..:.|   |:.:|  :....|.     |......|:..|.|.:::..|.|.|.|
Zfish   244 AFFTCQAEAYPGNLTYTWFWEEDN--VFFKNDL-----KRRVSILIDGSLIISQVKPEDAGKYTC 301

  Fly   390 ISKNSIG 396
            ...||:|
Zfish   302 SPSNSLG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 31/139 (22%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/24 (8%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 31/95 (33%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 20/73 (27%)
Ig strand B 328..332 CDD:409353 0/3 (0%)
Ig strand C 341..346 CDD:409353 2/7 (29%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353
igsf9bbXP_068072154.1 Ig 41..113 CDD:409353 23/92 (25%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 57..61 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
IG_like 144..223 CDD:214653 31/95 (33%)
Ig strand B 155..159 CDD:409353 1/3 (33%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 189..193 CDD:409353 2/4 (50%)
Ig strand F 203..208 CDD:409353 3/4 (75%)
Ig strand G 216..219 CDD:409353 1/3 (33%)
Ig 227..319 CDD:472250 22/89 (25%)
Ig strand B 244..248 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 284..288 CDD:409353 1/3 (33%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 312..315 CDD:409353
Ig <343..403 CDD:472250
Ig strand C 353..358 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 392..397 CDD:409353
Ig 427..504 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 449..453 CDD:409353
Ig strand E 470..474 CDD:409353
Ig strand F 484..489 CDD:409353
FN3 <489..>734 CDD:442628
Ig strand G 497..500 CDD:409353
FN3 509..604 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.