| Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_068072154.1 | Gene: | igsf9bb / 569554 | ZFINID: | ZDB-GENE-091112-15 | Length: | 1448 | Species: | Danio rerio |
| Alignment Length: | 332 | Identity: | 87/332 - (26%) |
|---|---|---|---|
| Similarity: | 117/332 - (35%) | Gaps: | 84/332 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNN 161
Fly 162 DRLSVQHND---------YNTWTLNIRGVKMEDAGKYMCQ--------------------VNTDP 197
Fly 198 MKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQ 262
Fly 263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTD 327
Fly 328 VTLICNVEASPKAINY---WQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKC 389
Fly 390 ISKNSIG 396 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-beta | NP_001138225.1 | Ig | 98..209 | CDD:472250 | 31/139 (22%) |
| Ig strand B | 115..119 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 139..143 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 174..178 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 188..193 | CDD:409353 | 2/24 (8%) | ||
| Ig strand G | 202..205 | CDD:409353 | 1/2 (50%) | ||
| Ig | 211..307 | CDD:472250 | 31/95 (33%) | ||
| Ig strand B | 230..234 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 243..247 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 272..276 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 286..291 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 300..303 | CDD:409353 | 0/2 (0%) | ||
| IG_like | 327..405 | CDD:214653 | 20/73 (27%) | ||
| Ig strand B | 328..332 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 341..346 | CDD:409353 | 2/7 (29%) | ||
| Ig strand E | 365..376 | CDD:409353 | 2/10 (20%) | ||
| Ig strand F | 386..391 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 399..402 | CDD:409353 | |||
| igsf9bb | XP_068072154.1 | Ig | 41..113 | CDD:409353 | 23/92 (25%) |
| Ig strand B | 41..45 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 57..61 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 94..98 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 108..113 | CDD:409353 | 2/4 (50%) | ||
| IG_like | 144..223 | CDD:214653 | 31/95 (33%) | ||
| Ig strand B | 155..159 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 168..172 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 189..193 | CDD:409353 | 2/4 (50%) | ||
| Ig strand F | 203..208 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 216..219 | CDD:409353 | 1/3 (33%) | ||
| Ig | 227..319 | CDD:472250 | 22/89 (25%) | ||
| Ig strand B | 244..248 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 258..262 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 284..288 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 298..303 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 312..315 | CDD:409353 | |||
| Ig | <343..403 | CDD:472250 | |||
| Ig strand C | 353..358 | CDD:409353 | |||
| Ig strand E | 378..382 | CDD:409353 | |||
| Ig strand F | 392..397 | CDD:409353 | |||
| Ig | 427..504 | CDD:472250 | |||
| Ig strand B | 436..440 | CDD:409353 | |||
| Ig strand C | 449..453 | CDD:409353 | |||
| Ig strand E | 470..474 | CDD:409353 | |||
| Ig strand F | 484..489 | CDD:409353 | |||
| FN3 | <489..>734 | CDD:442628 | |||
| Ig strand G | 497..500 | CDD:409353 | |||
| FN3 | 509..604 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||