DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and PSG6

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_002773.1 Gene:PSG6 / 5675 HGNCID:9523 Length:435 Species:Homo sapiens


Alignment Length:294 Identity:61/294 - (20%)
Similarity:101/294 - (34%) Gaps:83/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 ITNNDRLSVQHN---DYNTWTLNIRGVKMEDAGKYMCQV-------NTDPMKMQTATLEVVIP-P 211
            :.|...|.:.|.   .....||.:.||....||.|.|::       .:||:   |..|...:| |
Human   180 LLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPV---TLNLLPKLPMP 241

  Fly   212 DI----INEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGE 272
            .|    :|.....|::.       ..|..:......|.|.......:..|       ..:.:|..
Human   242 YITINNLNPREKKDVLA-------FTCEPKSRNYTYIWWLNGQSLPVSPR-------VKRPIENR 292

  Fly   273 MLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLT------DVTLI 331
            :|.|..:||:|.|.|.|...:......|..:.|.|.:.|  .:|...   |..|      ::.|.
Human   293 ILILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGP--DLPRIY---PSFTYYRSGENLDLS 352

  Fly   332 CNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIG 396
            |..:::|.|...| ..||:..::|.:                |.|.::.::..|.|.|..:||  
Human   353 CFADSNPPAEYSW-TINGKFQLSGQK----------------LFIPQITTNHSGLYACSVRNS-- 398

  Fly   397 DTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQ 430
                        ..||         |:||:.:|:
Human   399 ------------ATGK---------EISKSMIVK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 15/60 (25%)
ig 102..195 CDD:278476 11/46 (24%)
IG_like 219..307 CDD:214653 16/87 (18%)
Ig 221..307 CDD:299845 16/85 (19%)
Ig 311..404 CDD:299845 19/98 (19%)
IG_like 327..405 CDD:214653 15/77 (19%)
PSG6NP_002773.1 Ig_CEACAM_D1 36..139 CDD:143251
Cell attachment site. /evidence=ECO:0000255 126..128
Ig 147..235 CDD:299845 14/57 (25%)
Ig 241..328 CDD:299845 19/100 (19%)
IG_like 259..327 CDD:214653 15/74 (20%)
Ig_2 334..412 CDD:290606 24/121 (20%)
IG_like 338..398 CDD:214653 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.