DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and PSG1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001284702.1 Gene:PSG1 / 5669 HGNCID:9514 Length:428 Species:Homo sapiens


Alignment Length:391 Identity:84/391 - (21%)
Similarity:136/391 - (34%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GTGTGSGCGPAIRWQ-LLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCV 120
            ||.:...|...|:|: |||...|.|..:|..:.:::          |..|...:::|:|...  :
Human     2 GTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVT----------IEAEPTKVSEGKDVLL--L 54

  Fly   121 VNNLGGHRVSGDGSSAPAKVAWIKADAKAI------LAIHEHVITNNDRLSVQHNDYNTWTLNIR 179
            |:|| ...::|        ..|.|...:.:      ..:...:|......|.:...|:..:|.|:
Human    55 VHNL-PQNLTG--------YIWYKGQMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQ 110

  Fly   180 GVKMEDAGKYMCQV--NTDPMKMQTA----TLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG 238
            .|..||||.|...:  ..|..:..|.    ||.:..|...|:..........|  :..|.|....
Human   111 NVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSSNLNPRETME--AVSLTCDPET 173

  Fly   239 HPKPKITWRREDGREIIARNG-----SHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPT 298
            .....:.|          .||     :|....:::  ...|.|..:|:...|.|.|...|.|..:
Human   174 PDASYLWW----------MNGQSLPMTHSLKLSET--NRTLFLLGVTKYTAGPYECEIRNPVSAS 226

  Fly   299 VSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTL-------ICNVEASPKAINY----WQRENGEMI 352
            .|..:.|.:    |.::|.     |.:|...|       :.|....||:.||    |.  ||:.:
Human   227 RSDPVTLNL----LPKLPK-----PYITINNLNPRENKDVLNFTCEPKSENYTYIWWL--NGQSL 280

  Fly   353 IAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIR--------LYEMER 409
            ....| .....||.      ||.:..:..::.|.|:|    .|.|..|.||        ||..:.
Human   281 PVSPR-VKRPIENR------ILILPSVTRNETGPYQC----EIRDRYGGIRSDPVTLNVLYGPDL 334

  Fly   410 P 410
            |
Human   335 P 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 25/122 (20%)
ig 102..195 CDD:278476 21/100 (21%)
IG_like 219..307 CDD:214653 17/92 (18%)
Ig 221..307 CDD:299845 17/90 (19%)
Ig 311..404 CDD:299845 26/111 (23%)
IG_like 327..405 CDD:214653 22/96 (23%)
PSG1NP_001284702.1 Ig_CEACAM_D1 36..138 CDD:143251 23/122 (19%)
IG_like 41..>121 CDD:214653 19/90 (21%)
Ig 148..236 CDD:299845 18/105 (17%)
IG_like 163..221 CDD:214653 13/71 (18%)
Ig 241..329 CDD:299845 24/105 (23%)
IG_like 256..328 CDD:214653 21/84 (25%)
Ig_2 335..413 CDD:290606 1/1 (100%)
IG_like 339..413 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.