DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and tmigd1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001091718.3 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:249 Species:Danio rerio


Alignment Length:273 Identity:62/273 - (22%)
Similarity:110/273 - (40%) Gaps:61/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLLLLLGNCID-LTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136
            ||||...:|:. :||.:...:||:.          :..|.....|.||:.:|        ...|:
Zfish     9 LLLLCCVSCVKAVTVESCPLAVGSL----------LQTAVEETVTLTCMTDN--------TDPSS 55

  Fly   137 PAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGK-YMCQVNTDPMKM 200
            ..::.|.:..|:..|.              :.|..:..:|.::.|..||.|. :.||:..|....
Zfish    56 QQELQWFRNGARVKLP--------------EENMMSRSSLCVQPVTKEDDGAVFTCQLKGDASVN 106

  Fly   201 QTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTK 265
            .|...:|..||| :|:.|  ::.|.|...|.|.|..|.:|...:.|:: ||..:....||::.|.
Zfish   107 STVEFDVRYPPD-LNDTT--EVFVQETNDAVLSCEVRANPPVTVVWKK-DGEVLDLTTGSYKSTN 167

  Fly   266 ----AQSVEGEMLTLSKITRS-EMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVG---A 322
                ||      ||:.|:.|. ..|.|:|...:.:.....:..:        |.|.::::|   .
Zfish   168 NGITAQ------LTIPKLKRDVHQGLYVCETKSAMYGVTGRTFQ--------VTVEDRVIGFPLG 218

  Fly   323 PVLTDVTLI-CNV 334
            |.:..|.:: |.:
Zfish   219 PTIAGVVVVACTI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 20/111 (18%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 1/5 (20%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 26/100 (26%)
Ig strand B 230..234 CDD:409353 2/3 (67%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 2/9 (22%)
Ig strand B 328..332 CDD:409353 1/4 (25%)
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
tmigd1NP_001091718.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.