DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and zgc:112965

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001018542.1 Gene:zgc:112965 / 553735 ZFINID:ZDB-GENE-050522-10 Length:325 Species:Danio rerio


Alignment Length:186 Identity:34/186 - (18%)
Similarity:73/186 - (39%) Gaps:39/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KVAWIKADAKAILAIHEHVITNNDRLSVQHNDYN-------------TWTLNIRGVKMEDAGKYM 190
            :|.|.:||::.::.:::   ....|..||..||:             .::|.:..:..:|.|:|.
Zfish    63 EVEWRRADSETLVHLYQ---DGESRAEVQQQDYHDRAHFFTEEIQHGNFSLRLDNLTAQDEGEYR 124

  Fly   191 CQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKP----KITWRRED- 250
            |:|::.....:| .:::.....::...|:..:.:..|....|.|....|..|    ::.||:.| 
Zfish   125 CRVHSQQDSEET-VIKIK
DVERLLVSGTNRSVSIHVGEDVTLNCSVDSHITPEHIEEVLWRKTDK 188

  Fly   251 ----------GREIIARNGSHQ-KTKAQSVEGEM------LTLSKITRSEMGAYMC 289
                      ..:.:...|..| :.:.:....|:      |.|..:...:.|.|||
Zfish   189 DGDILILLYQNNKTVPEVGDEQFRGRVEFFTAEIPKGNFSLKLKSVRTEDKGVYMC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 16/82 (20%)
ig 102..195 CDD:278476 15/68 (22%)
IG_like 219..307 CDD:214653 17/93 (18%)
Ig 221..307 CDD:299845 17/91 (19%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
zgc:112965NP_001018542.1 IG_like 36..141 CDD:214653 16/81 (20%)
Ig 44..141 CDD:299845 16/81 (20%)
V-set 151..250 CDD:284989 18/94 (19%)
IG_like 153..257 CDD:214653 17/92 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.