DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and KIRREL1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:498 Identity:104/498 - (20%)
Similarity:157/498 - (31%) Gaps:187/498 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLENVTIAQGRDATFTCVVN---NLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVIT 159
            |...:.:|..|:.:|....|||...   .:.|:|.        ||..::..||      ||....
Human   223 PTVTLSIEPQTVQEGERVVFTCQATANPEILGYRW--------AKGGFLIEDA------HESRYE 273

  Fly   160 NNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATL-------EVVIPPDIINEE 217
            .|       .||:.:|..:           .|:|:........:||       .:|:.|    :.
Human   274 TN-------VDYSFFTEPV-----------SCEVHNKVGSTNVSTLVNVHFAPRIVVDP----KP 316

  Fly   218 TSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKT--KAQSV-EGEMLTLSKI 279
            |:.|:    |....|.|...|:|...:||.::|........||..:.  .||.: ....|.|..:
Human   317 TTTDI----GSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLKSV 377

  Fly   280 TRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYW 344
            |:::.|.|.|.|   :.|.:....:         :||..:.|.|::           |.:|:.|.
Human   378 TQADAGTYTCRA---IVPRIGVAER---------EVPLYVNGPPII-----------SSEAVQYA 419

  Fly   345 QRENG---EMIIAG----DRYALTEKEN-------NMYAIE---------MILHIKRLQSSDF-G 385
            .|.:|   |..|..    ||.|...|||       ..|.:|         ..|.|..:..:|| .
Human   420 VRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQT 484

  Fly   386 GYKCISKNSIGDTEGTIRLYEME----------RPGKKIL------------------------- 415
            .|.|.:.||.|.....|:|.|.|          ..|..||                         
Human   485 HYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGSRKDVTL 549

  Fly   416 --------------------RDDDLNEVS-------------KNEVVQK--------DTRSEDGS 439
                                |:||...||             |::|..|        |||.|...
Human   550 RKLDIKVETVNREPLTMHSDREDDTASVSTATRVMKAIYSSFKDDVDLKQDLRCDTIDTREEYEM 614

  Fly   440 RNLNGRLYKDRAPDQHPAS-----------GSDQLLGRGTMRL 471
            ::.....|..||.:..|:|           |..:..||.:.||
Human   615 KDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRL 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 23/120 (19%)
ig 102..195 CDD:278476 20/95 (21%)
IG_like 219..307 CDD:214653 21/90 (23%)
Ig 221..307 CDD:299845 21/88 (24%)
Ig 311..404 CDD:299845 29/116 (25%)
IG_like 327..405 CDD:214653 25/101 (25%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236
I-set 223..304 CDD:254352 23/112 (21%)
Ig_2 227..305 CDD:290606 22/109 (20%)
Ig_2 311..405 CDD:290606 26/113 (23%)
IG_like 314..405 CDD:214653 25/110 (23%)
Ig5_KIRREL3 407..504 CDD:143306 27/107 (25%)
IG_like 416..504 CDD:214653 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.