DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and iglon5

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:361 Identity:88/361 - (24%)
Similarity:152/361 - (42%) Gaps:76/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVI 158
            ||...:|....:|:|:.:|......|.::....|:            ||:  :...||.......
Zfish    23 GAQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHK------------AWL--NRSNILFTGTDKW 73

  Fly   159 TNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMC--QVNTDPMKMQTA--TLEVVIPPDIINEETS 219
            :.:.|:|:::|:.:.:::.|..|.:.|.|.|.|  |....|   :||  .|.|.:|..|:|  .|
Zfish    74 SLDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARNKP---RTAHVYLIVQVPARIVN--IS 133

  Fly   220 GDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEM 284
            .|..|.||....|.|.|.|.|:|.|||:  |.:..:..            |||.|.:::|.|.:.
Zfish   134 QDKSVNEGEDVNLFCLAVGRPEPTITWK--DFKYGLLN------------EGEFLEITEIKRHQA 184

  Fly   285 GAYMCIASNGVPPTVSKRMKLQVHFHPLV----QVPNQLVGAPVLTDVTLICNVEASPKAINYWQ 345
            ..:.||.:|||.|..::::|:.|::.|::    .:|.| ||...:    |.|...|.|.|...|.
Zfish   185 EDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNMPAQ-VGKTAI----LRCEAMAVPTASFEWY 244

  Fly   346 RENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERP 410
            |::...:.:.:...:..::.     ..:|....:....||.|.|.:.|.:|.:..::.|:   ||
Zfish   245 RDDRRPVESDNTLKIKNEKT-----RSLLLFTNVTEKHFGNYTCFASNRLGASNASMLLF---RP 301

  Fly   411 GKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRL 446
            |...                      .|:.:|||||
Zfish   302 GAVY----------------------GGAASLNGRL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 25/114 (22%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 0/3 (0%)
Ig strand F 188..193 CDD:409353 2/6 (33%)
Ig strand G 202..205 CDD:409353 2/4 (50%)
Ig 211..307 CDD:472250 30/95 (32%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 1/4 (25%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 14/77 (18%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
iglon5NP_001017775.2 Ig 35..123 CDD:472250 23/104 (22%)
Ig strand B 44..48 CDD:409353 0/3 (0%)
Ig strand C 56..60 CDD:409353 2/15 (13%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 2/2 (100%)
Ig 122..207 CDD:472250 32/100 (32%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 2/3 (67%)
Ig strand E 172..176 CDD:409353 2/3 (67%)
Ig strand F 186..191 CDD:409353 1/4 (25%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..287 CDD:464046 17/86 (20%)

Return to query results.
Submit another query.